KEGG   Lachancea thermotolerans: KLTH0E02068gHelp
Entry
KLTH0E02068g      CDS       T01117                                 

Definition
KLTH0E02068p
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
lth  Lachancea thermotolerans
Brite
Enzymes [BR:lth01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     KLTH0E02068g
Peptidases [BR:lth01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   KLTH0E02068g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
E:complement(188805..189506)
Genome map
AA seq 233 aa AA seqDB search
MSLPRSVVPLESNPEVFTRFAHELGLSPEYAVHDIYSLTEPDLMAFLPRPMKAIVLLFPI
NDVYESSKDTSTRNEGASQASPIWFKQTVKNACGLYALLHSLANNPDTLQENSKISHFLS
SNPRPDNRFADEKTDEFIVSISELYNKNSSYGQTAVPQAEDEVNLHFITYVKSGDYIFEM
DGRRNGANLLGTSSSQDLLEEPLVRERVEWYMNNADENMKLSFSLLGLAPSWD
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgtctttgcctcgttcagtagtgcctctggaatctaatccagaagtcttcacaagattc
gctcatgagttgggattatcgccagaatacgcagttcatgacatttactcgctgactgag
ccggacctgatggcctttttaccacgccccatgaaagcaattgtcttgttgtttcctatc
aacgatgtttacgagtcttccaaggatacatcgactcgcaatgaaggtgcctcacaggcc
tcaccaatttggttcaaacaaacggttaaaaatgcttgcggattgtatgctctactgcac
tctctggcgaataacccagatactctgcaagagaactccaaaatctcccactttctatcg
tcaaatcctaggcccgacaataggtttgccgacgagaaaacagacgaatttatcgtatcc
ataagcgaactgtacaacaagaactcgtcatatggccaaaccgctgtgccacaagcagaa
gacgaagtaaaccttcattttatcacgtatgtcaagtcgggggattacattttcgagatg
gatggccggagaaacggcgctaaccttttgggcacgtcctcgtcccaagatctgctggaa
gagccacttgtccgggagagggttgagtggtacatgaataatgctgacgagaatatgaag
ctaagcttttcgcttttaggtctagcgccttcgtgggattga

DBGET integrated database retrieval system