KEGG   Lachancea thermotolerans: KLTH0E05654gHelp
Entry
KLTH0E05654g      CDS       T01117                                 

Definition
KLTH0E05654p
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
lth  Lachancea thermotolerans
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:lth00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
E:complement(499361..501421)
Genome map
AA seq 686 aa AA seqDB search
MTAAAPTGATEEPSEVPLVASIDVGTTSSRVILFNMLGQEVSKHQIEYSTSASREKYAPV
GKRRHSVDETTAAAAGGGSDSRRASRASPPSPAQPIFSAEGIAIEANEYLEIEDLERPSV
PTLSFPRAGWVECNPLGILAHVVQCFAANLVSVDRVNGSRVSNGLAPYRIRCVGIANMRE
TTLVWSRKTGEPVVPYGIVWNDTRTSAIVTEKRNSTPQAVQDRLRAKTGLPLYSTYFSCS
KLRWLLDNEPAVRACYDAGDLMFGTVDTWLIYHLTSNRAFVSDVTNASRTGFMNLDTLVY
DDELLNYWDLARDKVNLPRIVSSAEYYGDFALPECVRTNLTPVAWSLLTDFCARTPAVPI
QGCLGDQSASLVGQLAFKPGAAKCTYGTGCFLLYNTGTKKLISSHGALTTFGYWFPHLEN
EEHAQPHFALEGSVAVAGAVVQWLRDNLRLIPKAEDIGPLASRVSDTGGVVFVPAFSGLF
APYWDASARATIMGMSQHTTASHLARAAVEGVCFQARAILKAMSSDAAGEGRKDRDFLEE
VADGTYEKAPLSMLAVDGGMSRSKEVMQIQADILGPCVKVRTSASSECTALGAAIAAALA
YEKREDRVLWKDLKDVKKWVMYGGTEPGNRPPVDEESFRTRIFRSKSIDTERRRKWKLWE
AAIERSRGWMNIVEQSTHDNATAKNM
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccgcagcgccaacgggggccaccgaagagcccagcgaggtgccgctggtggcg
tcgatcgacgtggggacgacttcgtcccgcgtgatcttgttcaacatgctgggccaggaa
gtgtccaagcaccagattgagtactccacgtccgcatcgcgcgagaagtacgcgcccgtg
ggcaagcggcgccacagcgtagacgagacgacggcggccgcggccggcggcggcagcgac
agccgccgcgccagccgggctagcccgcccagccccgcgcagccgatcttctccgcggaa
ggcattgcgatcgaggccaacgagtacctcgagatcgaggacctcgagcggcccagcgtg
cccacgctgagcttcccgcgcgccgggtgggtcgagtgcaacccgctgggcatcctcgcg
cacgtggtgcagtgcttcgcggccaacctggtgagcgtggaccgcgtcaacggcagccgc
gtgtcgaacgggctcgcgccctaccgcatccgctgcgtcggcatcgccaacatgcgggag
acgacgctggtgtggtcgcggaagacgggcgagccggtcgtcccgtacgggatcgtgtgg
aacgacacgcgcacgtctgccatcgtgaccgagaagcgcaacagcacgccgcaggccgtg
caggaccggctgcgcgccaagaccgggctgccgctgtactcgacgtacttctcgtgctcg
aagctgcgctggctgctggacaacgagcccgcggtgcgcgcatgctacgacgcgggcgac
ctgatgtttggcaccgtggacacgtggctcatctaccacctgacctcgaaccgcgcgttt
gtgtcggacgtgacgaacgcgtcgcgcacggggttcatgaacctggacaccctggtctac
gacgacgagctgctgaactactgggacctcgcgcgtgacaaggtgaacctgccgcggatc
gtgtcgtccgcggagtactacggcgacttcgcgctgcccgagtgcgtgcgcacgaacctc
acgcctgtcgcgtggagcctgctgacggacttctgcgcgcgcacgcccgcggtgcccatc
cagggctgcctgggcgaccagagcgcgtcgctcgtgggccagctcgcgttcaagcccggc
gcggccaagtgcacatacggcacgggctgcttcctgctgtacaacacgggcaccaaaaaa
ctgatctccagccacggcgcgctcacgacgtttggctactggttcccgcaccttgagaac
gaggagcacgcgcagccgcactttgcgctcgagggctccgtcgccgtcgcgggcgccgtg
gtccagtggctgcgcgacaacctgcgcctaatccccaaggccgaggacatcggccctctc
gcgtcccgcgtctcggacacgggcggcgttgtgttcgttcccgcgttcagcggcctcttc
gcgccctactgggacgccagcgcgcgcgcgacgatcatgggcatgtcacagcatacgacc
gcgtcgcacctggcccgcgctgccgtcgagggcgtctgcttccaggcccgcgccatcttg
aaggcgatgagctctgacgcggcaggcgagggccgcaaggaccgcgacttcctcgaggag
gtcgcggacggcacctacgagaaggcaccactgtccatgcttgcagtcgacggagggatg
tcgcgttcgaaggaggttatgcagatccaggccgatatcctgggcccctgcgtgaaagta
cggacctccgcgagctccgagtgtaccgcgctcggcgccgcgattgccgcggcgctggcg
tacgagaaacgcgaggaccgcgtcttgtggaaggacctcaaagacgtcaagaagtgggtc
atgtacggtggcacggagcccggcaacagaccacccgtggatgaagagtccttccgcaca
cgcatcttcagatccaagtcgatcgacactgaaaggagaaggaagtggaagctgtgggag
gctgcgattgagaggtccagaggctggatgaacattgtggagcagagcacccacgataac
gcgacggccaagaacatgtag

DBGET integrated database retrieval system