KEGG   Lachancea thermotolerans: KLTH0E06314gHelp
Entry
KLTH0E06314g      CDS       T01117                                 

Definition
KLTH0E06314p
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
lth  Lachancea thermotolerans
Pathway
mRNA surveillance pathway
Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:lth00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    KLTH0E06314g
 Cellular Processes
  Cell growth and death
   04113 Meiosis - yeast
    KLTH0E06314g
Enzymes [BR:lth01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     KLTH0E06314g
Protein phosphatases and associated proteins [BR:lth01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     KLTH0E06314g
Transcription machinery [BR:lth03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     KLTH0E06314g
Spliceosome [BR:lth03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    KLTH0E06314g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
E:complement(join(577084..577842,578360..578536))
Genome map
AA seq 311 aa AA seqDB search
METPAVDLDNIIDRLLEVRGSKPGQQVDLEEHEIRFLCSKARSIFIKQPILLELEAPIKI
CGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFIL
RGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFCMHGGLSPDLN
TMEQIRRVMRPTDIPDVGLLCDLLWSDPDKDIVGWSENDRGVSFTFGPDVVSRFLQKQDM
ELICRAHQVVEDGYEFFSKRQLVTLFSAPNYCGEFDNAGAMMSVDESLLCSFQILKPAQK
TLPRPQGKKKK
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggaaacgccggctgtggatctagataatatcatcgatcggttgctggaagtgagagga
tcgaagccaggccagcaggttgacctggaggagcacgagatccggtttctgtgctcgaaa
gcaagatcgattttcatcaagcagccgatcctgctagagctagaggcgcctattaagatt
tgtggtgacattcacggccagtactacgacctactgcgtctgttcgagtacggcggcttt
cccccagagagtaactacctcttcctgggcgactacgtggatcgtggtaagcagtcgctg
gagactatctgtctattgctagcatacaaaatcaaatacccggaaaacttcttcattctg
agaggcaatcacgagtgcgcgtccattaatcgtatttacgggttctatgatgagtgtaag
cgtcgctacaacatcaagctttggaaaaccttcacagactgcttcaattgtctgcctatt
gcggccataattgacgaaaaaatcttttgcatgcacggtgggttgtcgcccgacctcaac
actatggaacaaatcagacgcgtcatgcggccaaccgatatcccagatgtggggctgcta
tgtgacctgttgtggtccgatccagacaaggatattgtcgggtggtccgagaacgatcgt
ggtgtatcgttcacgttcgggcccgacgtcgtcagtcgcttcctacaaaaacaagacatg
gagcttatctgcagagcgcaccaggtggtggaggacggttacgagtttttcagcaaacgt
cagttggtgacccttttcagtgctccaaactactgtggcgagttcgacaatgctggtgca
atgatgagcgtggacgagagcttattgtgctccttccagattttgaagccagcgcaaaag
actttgccaagaccccagggcaagaagaaaaaatga

DBGET integrated database retrieval system