KEGG   Lachancea thermotolerans: KLTH0E07348gHelp
Entry
KLTH0E07348g      CDS       T01117                                 

Definition
KLTH0E07348p
Orthology
K01694  
tryptophan synthase [EC:4.2.1.20]
Organism
lth  Lachancea thermotolerans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:lth01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:lth00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:lth00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
E:complement(679054..681183)
Genome map
AA seq 709 aa AA seqDB search
MAELLRRTFANAKSENRNALVTFMTAGYPRVEDTIPILKGFQDGGVDVIELGMPFSDPIA
DGPTIQVANTVALQNGVTMTQTLDMVRQARAEGVTVPIILMGYYNPILSYGEQKFIEDAA
EAGASGFIIVDLPPEEAIKVRNFVDDKGLSLIPLVAPSTTDQRLELLAQIATSFIYVVSR
MGTTGAQTSVADDLTELVERVRKYTKDIPLAVGFGVSTREHFTTVGSVSDGVVIGSKIIK
LIEEAKEDERYITAKQYVEGILAGKKHKNLSVNEFKALQTESINAGKKNAAKAADFSEVH
KFKATFGDFGGQYVPEALHACLRELEQGFESAVADPIFWKEFRDLYSYIGRPSSLHRAER
LSEYCGGAQIWLKREDLNHTGSHKINNALAQVLIAKRLGKKKIIAETGAGQHGVATATAC
AKFGMECTVFMGAEDVRRQALNVFRMRILGAKVVAVTNGTKTLRDATSEAFRFWVSNLKT
THYVVGSAIGPHPYPILVRTFQSVIGNETKEQFAKLNDGKLPDAIVACVGGGSNSTGMFS
PFEKDTSVKFLGVEAGGDGVDTKFHSATLTAGRPGVFHGVKTYVLQDVDGQVHDTHSVSA
GLDYPGVGPELASWKASGRATFIAATDAQALEGFKLLSQLEGIIPALESSHAVYGAVQLA
KTMDKNQNIIINVSGRGDKDVQSVAEVLPKLGPQIGWDLRFEEDPTAQL
NT seq 2130 nt NT seq  +upstreamnt  +downstreamnt
atggccgaactactgagaaggacgtttgccaacgccaaatccgaaaaccgcaatgccctt
gttacctttatgacagccggctatccaagagtggaagacaccattccaatcctaaaaggg
ttccaagatggaggcgttgacgtaattgagcttggtatgcctttttccgaccccattgct
gatggcccaactattcaggtcgctaatacggtcgctctccaaaacggcgtgactatgact
caaactttggatatggttcgccaagcgagagccgaaggcgtaactgtgccgatcattctc
atgggatactacaaccccatcttgagctatggagagcagaagtttatcgaagatgccgca
gaggcaggtgccagtggttttatcatcgttgacctacctccagaagaagccatcaaggtt
agaaacttcgttgatgacaaaggactaagtttgattccactagtagccccatccacaact
gaccagcgtttggagcttctggcacaaattgcaacgtcatttatctatgttgtgtctaga
atgggcaccaccggtgcgcaaacctctgttgctgatgacttaacagaacttgtcgagcgt
gttcgcaaatataccaaggacattccgctcgcggtcggattcggtgtttcaactagagaa
cacttcaccacggttggatccgtctctgacggtgtggtcattggctctaaaattatcaag
ttgatcgaggaggccaaagaagatgaaagatacatcactgctaagcaatatgtcgaagga
atcctcgccggcaaaaagcacaaaaacttatcagttaacgaattcaaggcactgcaaact
gaatccatcaatgcgggaaagaaaaacgcagctaaagccgctgactttagtgaagttcac
aaattcaaggcgaccttcggtgattttggtggacagtacgttcctgaagctctgcatgcc
tgtttgagagagttggaacaaggcttcgaaagcgctgttgctgatcctattttctggaag
gagttcagagacctatactcttacatcggtcgtccttcatcgctacacagagctgaacgt
ctaagtgagtactgcggcggtgcccagatctggttgaaaagagaggatttaaaccacacc
ggatctcacaagatcaacaacgctttggctcaagtgctgatcgctaaaagactgggtaaa
aagaagattattgcagaaaccggtgcaggtcaacacggtgtggctactgccaccgcatgt
gccaagtttggaatggaatgcacagtgttcatgggtgccgaagatgttcgtcgccaagct
ctaaatgtttttagaatgcgcattcttggagcaaaggttgtggctgttaccaacggtaca
aaaactttgagggatgctacatctgaagctttccgtttctgggtttcaaacttgaaaaca
acgcactacgttgtaggctccgctattggtcctcacccatacccgattttggtgcgtact
ttccagtcagttatcggaaatgaaacaaaagagcaattcgcaaagcttaacgatggaaag
ttacccgatgctattgtcgcctgtgtcggcggtggttccaactctacaggtatgttctct
ccctttgaaaaggacacatcagttaagttcctgggtgttgaagctggtggcgacggcgtg
gacactaaattccactctgccactttgactgctggtagaccaggtgtgttccacggcgtt
aaaacctacgtgttgcaagacgttgatggtcaagtccacgatactcactcggtctctgcg
ggtttggattaccccggtgtcggaccagagttggcttcatggaaggcttcaggacgcgct
acttttatagcagccactgacgctcaagcgctcgagggtttcaagctcctatcgcaattg
gaaggtattattcctgctttggaatcctctcatgctgtgtatggcgctgttcaattggcc
aaaacaatggacaaaaaccagaatattatcattaacgtatctgggagaggtgacaaagat
gtgcagagcgtcgctgaggtcctcccaaagctgggtcctcaaattggatgggatctgaga
tttgaagaagacccaacggctcaattgtaa

DBGET integrated database retrieval system