KEGG   Lachancea thermotolerans: KLTH0E07348gHelp
Entry
KLTH0E07348g      CDS       T01117                                 

Definition
(RefSeq) KLTH0E07348p
  KO
K01694  
tryptophan synthase [EC:4.2.1.20]
Organism
lth  Lachancea thermotolerans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lth00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    KLTH0E07348g
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    KLTH0E07348g
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    KLTH0E07348g
Enzymes [BR:lth01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     KLTH0E07348g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
E:complement(679054..681183)
Genome map
AA seq 709 aa AA seqDB search
MAELLRRTFANAKSENRNALVTFMTAGYPRVEDTIPILKGFQDGGVDVIELGMPFSDPIA
DGPTIQVANTVALQNGVTMTQTLDMVRQARAEGVTVPIILMGYYNPILSYGEQKFIEDAA
EAGASGFIIVDLPPEEAIKVRNFVDDKGLSLIPLVAPSTTDQRLELLAQIATSFIYVVSR
MGTTGAQTSVADDLTELVERVRKYTKDIPLAVGFGVSTREHFTTVGSVSDGVVIGSKIIK
LIEEAKEDERYITAKQYVEGILAGKKHKNLSVNEFKALQTESINAGKKNAAKAADFSEVH
KFKATFGDFGGQYVPEALHACLRELEQGFESAVADPIFWKEFRDLYSYIGRPSSLHRAER
LSEYCGGAQIWLKREDLNHTGSHKINNALAQVLIAKRLGKKKIIAETGAGQHGVATATAC
AKFGMECTVFMGAEDVRRQALNVFRMRILGAKVVAVTNGTKTLRDATSEAFRFWVSNLKT
THYVVGSAIGPHPYPILVRTFQSVIGNETKEQFAKLNDGKLPDAIVACVGGGSNSTGMFS
PFEKDTSVKFLGVEAGGDGVDTKFHSATLTAGRPGVFHGVKTYVLQDVDGQVHDTHSVSA
GLDYPGVGPELASWKASGRATFIAATDAQALEGFKLLSQLEGIIPALESSHAVYGAVQLA
KTMDKNQNIIINVSGRGDKDVQSVAEVLPKLGPQIGWDLRFEEDPTAQL
NT seq 2130 nt NT seq  +upstreamnt  +downstreamnt
atggccgaactactgagaaggacgtttgccaacgccaaatccgaaaaccgcaatgccctt
gttacctttatgacagccggctatccaagagtggaagacaccattccaatcctaaaaggg
ttccaagatggaggcgttgacgtaattgagcttggtatgcctttttccgaccccattgct
gatggcccaactattcaggtcgctaatacggtcgctctccaaaacggcgtgactatgact
caaactttggatatggttcgccaagcgagagccgaaggcgtaactgtgccgatcattctc
atgggatactacaaccccatcttgagctatggagagcagaagtttatcgaagatgccgca
gaggcaggtgccagtggttttatcatcgttgacctacctccagaagaagccatcaaggtt
agaaacttcgttgatgacaaaggactaagtttgattccactagtagccccatccacaact
gaccagcgtttggagcttctggcacaaattgcaacgtcatttatctatgttgtgtctaga
atgggcaccaccggtgcgcaaacctctgttgctgatgacttaacagaacttgtcgagcgt
gttcgcaaatataccaaggacattccgctcgcggtcggattcggtgtttcaactagagaa
cacttcaccacggttggatccgtctctgacggtgtggtcattggctctaaaattatcaag
ttgatcgaggaggccaaagaagatgaaagatacatcactgctaagcaatatgtcgaagga
atcctcgccggcaaaaagcacaaaaacttatcagttaacgaattcaaggcactgcaaact
gaatccatcaatgcgggaaagaaaaacgcagctaaagccgctgactttagtgaagttcac
aaattcaaggcgaccttcggtgattttggtggacagtacgttcctgaagctctgcatgcc
tgtttgagagagttggaacaaggcttcgaaagcgctgttgctgatcctattttctggaag
gagttcagagacctatactcttacatcggtcgtccttcatcgctacacagagctgaacgt
ctaagtgagtactgcggcggtgcccagatctggttgaaaagagaggatttaaaccacacc
ggatctcacaagatcaacaacgctttggctcaagtgctgatcgctaaaagactgggtaaa
aagaagattattgcagaaaccggtgcaggtcaacacggtgtggctactgccaccgcatgt
gccaagtttggaatggaatgcacagtgttcatgggtgccgaagatgttcgtcgccaagct
ctaaatgtttttagaatgcgcattcttggagcaaaggttgtggctgttaccaacggtaca
aaaactttgagggatgctacatctgaagctttccgtttctgggtttcaaacttgaaaaca
acgcactacgttgtaggctccgctattggtcctcacccatacccgattttggtgcgtact
ttccagtcagttatcggaaatgaaacaaaagagcaattcgcaaagcttaacgatggaaag
ttacccgatgctattgtcgcctgtgtcggcggtggttccaactctacaggtatgttctct
ccctttgaaaaggacacatcagttaagttcctgggtgttgaagctggtggcgacggcgtg
gacactaaattccactctgccactttgactgctggtagaccaggtgtgttccacggcgtt
aaaacctacgtgttgcaagacgttgatggtcaagtccacgatactcactcggtctctgcg
ggtttggattaccccggtgtcggaccagagttggcttcatggaaggcttcaggacgcgct
acttttatagcagccactgacgctcaagcgctcgagggtttcaagctcctatcgcaattg
gaaggtattattcctgctttggaatcctctcatgctgtgtatggcgctgttcaattggcc
aaaacaatggacaaaaaccagaatattatcattaacgtatctgggagaggtgacaaagat
gtgcagagcgtcgctgaggtcctcccaaagctgggtcctcaaattggatgggatctgaga
tttgaagaagacccaacggctcaattgtaa

DBGET integrated database retrieval system