KEGG   Lachancea thermotolerans: KLTH0E09856gHelp
Entry
KLTH0E09856g      CDS       T01117                                 

Definition
KLTH0E09856p
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
lth  Lachancea thermotolerans
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:lth00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    KLTH0E09856g
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    KLTH0E09856g
   00630 Glyoxylate and dicarboxylate metabolism
    KLTH0E09856g
Enzymes [BR:lth01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     KLTH0E09856g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
E:complement(888231..889949)
Genome map
AA seq 572 aa AA seqDB search
MLKRLQAYPYRCSYSAVFARHSLQVTQMLENVQVLVDVDSTPRFAPSKTTVADILTPDAL
SFVVLLHRTFDERRRQLLRNRQEIQTKLDSGAYKFDFLSETRNIRENPAWQGAVPAPGLA
ERHSEITGPPLRNMLVNALNAPVSTYMTDFEDSAAPTWDNCVYGQVNLYDAIRDQVAFKT
PRKEYTLRDSFASLPTVLVRPRGWHMEEKHVIVDGRPISASLFDFGLYFFHNAHKLVEIG
KGPYFYLPKMEHHLEARLWNDVFNVAQDYIGMSRGTVRATVLIETLPAAFQMEEIIFELR
AHSAGLNCGRWDYIFSVIKRLRNDPAHVLPDRDHVTMTAPFMDAYVRRLIEICHRRGVHA
MGGMAAQIPIKNDTAANDAAMAKVRADKERELAKGHDGSWVAHPALSAICNEVFDKMGTA
NQIHSIPAANVAASDLLNTRIPNGAVTTAGIRQNLSIGLQYMEAWLRGSGCVPINNLMED
AATAEVSRCQLYQWVKHGVKLQDTGEVVTADLTQRILEEQVAELSKKSPVGDANKFALAA
KYFLPEIRGEKFSEFLTTLLYDEIVTAKTSRL
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atgctcaaacgtctccaggcctatccataccgctgtagttactcagcagtatttgcacgt
cattccttgcaagtcacccaaatgctagaaaacgttcaggtcctcgtcgacgtcgattcg
actccaaggttcgcgccttccaagactactgtggcagacatcctcacgcctgatgcactg
tcatttgtggtgcttctgcaccgcactttcgacgagcgtcgtcgtcagctcctgcgcaat
cgccaggaaatccaaaccaagctggactccggcgcctacaagttcgactttctgagcgag
acacgcaatatccgcgagaatccagcctggcagggcgcggtgcccgcgcccggcctggcc
gagcgtcactccgagatcacgggtcctccattacgtaacatgttggtcaacgcgctcaac
gctcccgtgtccacttacatgaccgacttcgaagactccgccgcgcctacctgggacaac
tgcgtctacggacaggtgaacctctacgacgctattcgcgaccaagtggctttcaagacg
cctagaaaggagtacacgctccgcgactcgtttgcgtcgcttcccacggtgctggtgagg
ccacgtggatggcacatggaggagaagcacgtcatcgtggatgggcgccccatctccgcg
tcgctgttcgacttcgggctctacttcttccacaatgcgcacaagctggtcgagataggc
aagggtccttacttctacctgcccaagatggagcaccacctcgaggcgcggctgtggaac
gacgttttcaacgtcgcccaggattacatcgggatgtcgcgtggaacggtgcgcgcaaca
gtgttgatcgagacactgcctgccgctttccagatggaagagatcatcttcgagctgcgc
gcgcactctgcaggtctgaactgcggtcgctgggactacattttcagcgtgatcaagcgc
ctccgcaacgaccccgctcacgttctgcccgaccgtgaccacgtgaccatgaccgcgccc
ttcatggacgcctatgtacgccgcttaatcgagatctgccaccgccgtggcgtgcacgcc
atgggcggtatggctgcccaaatcccaatcaagaacgacaccgcggccaacgacgctgca
atggcaaaggtccgcgccgacaaggagcgcgagctggccaagggccacgacggttcctgg
gttgcccaccccgctctctctgcgatctgcaacgaagtgttcgacaagatgggcactgcc
aaccaaattcacagtatccctgccgcgaacgtcgccgccagtgatcttctcaacacacgc
attccaaacggcgctgtcacaacggcaggcattagacagaacctgtctatcgggttgcaa
tatatggaggcgtggttgcgtggctccggctgtgtgccaatcaacaacctgatggaggat
gctgcaaccgcggaggtctcgcgttgtcagctgtaccaatgggtcaaacacggcgtcaaa
ttgcaggacactggcgaggtcgttactgcggacctcacacagcgcattctggaggaacag
gtcgctgagctctctaaaaagagccctgttggcgacgctaacaagttcgcgctagccgcg
aagtacttcctgcctgaaatcagaggcgagaagttcagcgaatttttgaccactttgctg
tacgacgaaattgtcactgctaaaacttctcggttgtag

DBGET integrated database retrieval system