KEGG   Lachancea thermotolerans: KLTH0E10186gHelp
Entry
KLTH0E10186g      CDS       T01117                                 

Definition
(RefSeq) KLTH0E10186p
  KO
K11252  histone H2B
Organism
lth  Lachancea thermotolerans
Brite
Chromosome and associated proteins [BR:lth03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    KLTH0E10186g
Exosome [BR:lth04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   KLTH0E10186g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa CENP-W YscO-like
Motif
Other DBs
NCBI-GeneID: 8292083
NCBI-ProteinID: XP_002553919
UniProt: C5DI71
Position
E:complement(921612..922010)
Genome map
AA seq 132 aa AA seqDB search
MSAKAEKKPASKAPAEKKPAAKKTASSVDASKKRTKVRKETYSSYIYKVLKQTHPDTGIS
QKSMSILNSFVNDIFERIASEASKLAAYNKKSTISAREIQTAVRLILPGELAKHAVSEGT
RAVTKYSSSTQA
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atgtctgccaaagccgagaaaaagccagcctccaaggccccagctgagaagaagccagct
gctaagaagaccgcttcctccgtcgacgccagcaagaagagaaccaaggtcagaaaggag
acttactcctcttacatctacaaggtgctgaaacaaactcacccagacaccggtatctca
caaaagtctatgtcgattctgaactcgttcgtcaacgacattttcgagagaatcgcctct
gaggcctccaagctagcggcttacaacaagaagtctaccatctccgccagagagatccag
accgctgtcagactgatcctgcctggtgaattggccaagcacgctgtgtccgaaggtacc
agagccgtgaccaagtactcgtcctccacccaggcttaa

DBGET integrated database retrieval system