KEGG   Lachancea thermotolerans: KLTH0E11638gHelp
Entry
KLTH0E11638g      CDS       T01117                                 

Definition
KLTH0E11638p
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
lth  Lachancea thermotolerans
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:lth00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    KLTH0E11638g
Enzymes [BR:lth01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     KLTH0E11638g
Exosome [BR:lth04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   KLTH0E11638g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
E:complement(1036695..1038311)
Genome map
AA seq 538 aa AA seqDB search
MEKASLMGKRPIKRRNKYRKLSHYAFALILLTVVVMSLPIGPSLEKFVSRKSSKKNVIFF
VTDGMGPASLSLSRSFRQFTQNLTIDDVLTLDHHLIGSSRTRSSDSLVTDSAAGATAFSC
ALKSYNGAIGVDPDKQPCGTILEAAKLQGYLTGLVVTTRITDATPAAFSAHADYRFQEDL
IAQQQLGDYPLGRMVDLMIGGGRTHFYSGTDIVYGSRGSRSDGRNLIKEAIGDGWSYVGN
REQFDALENGRNVSLPLLALLADYDIPFDFDRDASEYPSLKEEAMTAINALTEATKNSDK
GFFLLIEGSRIDHAGHQNDPAAQAREVLAFDEAFEAVLRFAEESDVETVMVSTSDHETGG
LVTARQITKAYPEYAWYPNVLDNAKHSGEFLRKMVQGYKGDSKSTFIEQDVFEDNLGITD
YSKADVEELLKLTSSGEINDKLNDMISTRAQIGWSTHGHSAVDVNIYAYANRRATWHNVL
ENLQGNHENTEIGQFMANYLGLNLQDVTKKLGKTKHSPTSSLSDLSLDADEYHHNLYI
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atggagaaggcatctttaatggggaagcgccccatcaagcggagaaacaaataccgcaag
ttgtctcattacgcttttgcgctcattcttcttacagtcgtggtgatgtccttgccaatt
gggccttctcttgagaaattcgtctcgaggaaatcatctaaaaagaatgttattttcttt
gttactgatggaatgggccctgcatctctgtcgctaagcaggtcttttcggcaatttacg
caaaacctgacaatcgacgacgtcctaacccttgaccatcaccttattgggtcatcccgt
actcgttcttctgactcactggtgacggactctgctgctggtgcaactgctttctcgtgt
gcattgaagtcatacaatggtgctatcggagttgaccccgacaaacaaccatgcggtact
attttagaggccgccaagctccaaggatacctaacagggctcgttgtcacaacaagaata
actgacgcaacccctgctgcattcagcgcacacgcagattatagattccaagaagacctt
atcgctcaacaacagcttggtgactaccctctagggcggatggttgacttgatgattgga
ggtggcagaacacacttttattcaggaactgatattgtttacggctcccgtggcagtcgt
tccgatggtcgtaatttgattaaggaggcgataggtgacgggtggagctatgttggtaat
cgcgagcagtttgatgcactagaaaatggacgtaatgtttctttgccccttctagctctt
cttgctgattatgatattccatttgatttcgatagggatgcttcggaatatccctcctta
aaagaggaagctatgactgccattaatgctttgactgaggcaacaaaaaactcggacaaa
ggtttcttcttgctcatcgaaggttccaggattgaccacgctggccatcaaaacgaccca
gctgcccaagcacgtgaagttctagcctttgatgaggcttttgaagcagttctaaggttt
gccgaagaaagtgatgtcgagacggtaatggtatcgacctcagaccatgaaactgggggt
cttgtaactgctcggcaaataacgaaggcttatcctgaatatgcttggtacccaaacgtt
ttggataacgcaaaacactctggagaattcctgagaaaaatggtgcaaggctacaaaggc
gacagcaagtccacattcatagaacaagacgtatttgaagacaatcttggcatcacagat
tattcgaaggctgacgtcgaagagttgctaaagctcacctctagcggcgagatcaatgac
aaattaaacgacatgatttcgacaagagcacagattggatggtctacgcacggtcatagt
gcagtcgatgttaacatttacgcatatgccaatcgtcgtgcgacttggcataatgtgctg
gaaaacttgcagggcaatcatgaaaacacagaaattggtcaattcatggccaattactta
ggcttgaatttgcaagatgtcactaaaaaactaggcaaaacaaaacactcgcctaccagc
tcattgtcggatctatcgctcgatgccgatgagtaccatcacaacctgtacatttga

DBGET integrated database retrieval system