KEGG   Lachancea thermotolerans: KLTH0E13068gHelp
Entry
KLTH0E13068g      CDS       T01117                                 

Definition
KLTH0E13068p
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
lth  Lachancea thermotolerans
Brite
Enzymes [BR:lth01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     KLTH0E13068g
Transfer RNA biogenesis [BR:lth03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    KLTH0E13068g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
E:1160992..1162659
Genome map
AA seq 555 aa AA seqDB search
MARRGPKTNKQKLAPEKERFIQCCSDITLELTNSLTSGSTKETNLNGLITKFSKKYKLKQ
QPRLTDIINSIPDQYKKYLLPKLKAKPVRTASGIAVVAVMCKPHRCPHIAYTGNICVYCP
GGPDSDFEYSTQSYTGYEPTSMRAIRARYDPYEQARGRVEQLKQLGHSIDKVEYIIMGGT
FMSLPKDYREDFIVKLHNALSGFNGNDIDEAIQFSQQSLTKCVGITIETRPDYCTHTHLD
DMLKYGCTRLEIGVQSLYEDVARDTNRGHTVKSVAETFCVAKDAGYKIVSHMMPDLPNVG
MERDIEQFKEYFENPAFRTDGLKIYPTLVIRGTGLYELWKTGRYKSYNANALVDLVARIM
ALVPPWTRIYRVQRDIPMPLVTSGVDNGNLRELALARMKDFGTTCRDVRTREVGIQEVHH
KVQPDQVELIRRDYYANGGWETFLSYEDPKQDILIGLLRLRKASKKYTYRKEFTSQRTSI
VRELHVYGSVVPLHSRDPRKFQHQGFGTLLMEEAARIAKEEHGSEKISVISGVGVRNYYA
KLGYELDGPYMSKKL
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atggcaaggcgtggacctaaaaccaacaaacaaaaattggcccccgagaaggagcgcttt
atccaatgttgttcggatataacattggaactgacgaactcgttaacatcgggttccacc
aaggaaaccaacttaaatgggcttatcactaagttttctaagaagtacaagcttaagcag
cagccccgcttgacagacatcatcaactctatccccgaccaatacaaaaaataccttctc
cctaagctaaaagccaagccggtgcgaaccgcgtcaggcatagcggtggtcgctgtcatg
tgcaagccccatagatgccctcacattgcatacactggtaacatctgtgtttactgtcct
ggtggaccagactccgactttgagtattctacacagtcgtacaccggttacgaacccact
tcgatgcgcgctattcgcgcccgttacgacccttacgaacaagctcgtggtagagtcgag
cagctcaagcaactggggcactcgatcgacaaagtcgagtatattatcatgggcggtact
tttatgtcccttccaaaggattatcgtgaagactttatagtcaagctgcacaacgccctc
tccggtttcaacggtaatgacatagacgaggctatccagttttcgcagcaaagtttgact
aagtgtgtgggtatcactatcgaaacaagaccagattactgcacacatacgcacctcgac
gacatgctgaagtatggttgtacgcgtctagaaattggcgtgcagtctctttacgaggac
gtcgctagagacacgaaccgtgggcatactgtgaagtcagttgctgagacattttgtgtg
gccaaggacgcaggctacaaaattgtctcgcatatgatgcctgacttgccaaacgttggt
atggaaagagatatcgagcagtttaaagagtatttcgagaaccctgctttcagaacagac
gggcttaaaatttacccaactctagtcataagaggaactggtttatatgaactttggaaa
acaggccgctacaagtcttacaacgctaatgcccttgtcgacttagtcgctcgtatcatg
gctctagttccaccctggactagaatttaccgtgtccagagagatattccaatgcctttg
gtgacttctggtgtcgacaacggtaatctgcgagagctagcgctggcgaggatgaaagat
tttggcacaacctgcagagatgtccgtacgagagaggtcggaatccaggaggtccatcac
aaagttcagcccgaccaagttgagctcatccgcagagactactacgccaacggcgggtgg
gaaacatttttgtcatatgaagatccaaagcaggacattttaataggacttctgcgactc
aggaaagcttccaagaagtacacttacaggaaagagttcacctcccaaagaacgtctatt
gtcagggagctgcatgtctatggttcagtggtgcctctgcattctagggacccgcgtaag
ttccagcaccagggattcggcacactgttgatggaagaagcagcgaggatagcaaaggaa
gaacatggttcagaaaaaatatcggtcatttctggtgttggtgtgaggaattactatgcc
aagctaggttacgaattagatggcccctatatgtctaagaagttgtaa

DBGET integrated database retrieval system