KEGG   Lachancea thermotolerans: KLTH0E15004gHelp
Entry
KLTH0E15004g      CDS       T01117                                 

Definition
KLTH0E15004p
Orthology
K08293  
mitogen-activated protein kinase [EC:2.7.11.24]
Organism
lth  Lachancea thermotolerans
Brite
Enzymes [BR:lth01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     KLTH0E15004g
Protein kinases [BR:lth01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [Table]
   KLTH0E15004g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
E:1328930..1330165
Genome map
AA seq 411 aa AA seqDB search
MFTSVALQSNPNLINQAQNKSKPAIYSNKNTDVADASSPGTLRTPYTTTASNIRTIYQKA
NFSTPGNFDILQVLGKGSYGTVVSAIDKNGSGKPRRLAIKKVTNIFAREILLKRAIRELK
FLNFFRGHKNIVSIVDLEIVTEKPYDGLYCYQELVEYDLARVIHSTVQFSEFHIRHFLYQ
ILCGLKYIHSAEVVHRDLKPGNILCSINGTLKICDFGLARGIAQRHFGTKGAELSITNYV
ATRWYRAPELILSRKKYTKAIDMWAVGCILAEFYGRKPIFMGQDSLHQISEILEILGTPP
RPIIAKYCSTRSWEIFSMRNEVKKRSWSSVYPFSCNHAHELLNALLDWDPDARPTAETAL
EHTFFVDLRNSEEEPICPHGTFDFSYENNFTSMTALRECLYDEVKAFKQQV
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgttcacatcggttgctcttcaatcaaatccgaatctcataaatcaggctcaaaacaaa
tcgaagccggcaatatacagtaacaagaacaccgatgttgcagatgcgagctctccagga
actttgagaacaccttacacaacaacggcttccaatattagaaccatatatcagaaagct
aatttctctacacctggtaactttgatattttacaagttttaggaaaaggatcatacggc
acagttgtttccgcaatagacaagaatggcagcggaaaaccaagacgcctagccataaaa
aaagtgacgaatatatttgccagagaaattctcttaaagcgggccatacgcgagttgaag
tttttgaatttctttagaggtcacaagaacattgtgagcattgttgatcttgagatcgtt
acagaaaaaccttacgatggcttgtactgttaccaagaacttgtagaatatgacttagca
agagttatacattcgactgtccaattttctgagtttcatatcagacattttttgtaccag
attttgtgcggtctcaaatacattcacagtgcggaagttgtccacagggacttaaagcca
ggaaatattctttgttcaataaatgggacactaaaaatatgtgattttggtcttgctaga
ggtattgctcaaagacactttggaacaaaaggagcggagctcagcattacaaactatgtg
gctacccggtggtatagggcgccagaattgatactttcccgtaaaaagtataccaaggct
attgatatgtgggcggttggttgtattctggccgaattttatggcagaaagcctatattc
atgggccaagactcacttcatcagatttctgagatacttgaaatcctgggaacaccgcca
cggccgatcatagcaaaatactgttccacaaggtcatgggagatattttcaatgaggaat
gaagtaaaaaagcgcagttggtcgtctgtttaccccttctcctgtaatcatgcgcatgaa
cttttaaatgcacttttagactgggaccctgacgcgcgtccaacggccgagactgcactg
gaacatactttttttgtggatttgcgtaattctgaagaagaacccatctgccctcatggg
acttttgatttctcctatgagaacaattttacttcaatgactgccttacgagaatgcctt
tatgatgaagttaaggcattcaaacaacaagtataa

DBGET integrated database retrieval system