KEGG   Lachancea thermotolerans: KLTH0F01100gHelp
Entry
KLTH0F01100g      CDS       T01117                                 

Definition
KLTH0F01100p
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
lth  Lachancea thermotolerans
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:lth04141]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
F:complement(84685..86250)
Genome map
AA seq 521 aa AA seqDB search
MQLSRNLFLGISALAAALGNAQQEATAPEGSAVVKLTSENFADFIKEHPLVLAEFYAPWC
GHCKTLAPHYVEAAATLESKNIPLAQVDCTTEEELCMEHGIRGYPTIKVFRNHQVDAPSD
YQGGRTASAIVSYMISQSLPPVSILEGEEAADDFKDLLAESSGAVIVDGGVEGLNETFHE
LAELFRDDFTFVQYNGSDAKQKLSVYLPKQDAPIVFEGKNASISHLVDWVQVETKPYFGD
INGETFQSYMDSNVPLAYFFYTSPEERASYEDFFSKLGKEHRGKINFVGLDASAFGRHAQ
NLNMKEQFPLFVIHDTVSNLKYGLPQLSEEEFSSLTKPLELKTKDIAKFIKSFISGKVEP
IIKSEEIPEKQESSVFRIVGKTHEDIINDETRDVLVKYYAPWCGHCKRLAPVYEELANVY
VTDKDAQDKVLVANVDATLNDVNVDLEGYPTLILYPAGNKSTPVVYQGARDMESLMNFIQ
ENGHHEINGTAILESKKAQEAKEADEEAEAIEEESVEHDEL
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgcaattgtccaggaatttgtttctagggatttctgctctggcagctgccctcggtaat
gctcagcaggaggccacggcccctgaaggcagcgcggtcgtcaaattgacatccgagaat
ttcgcagactttattaaagaacatcccttggtattggccgagttctatgcaccatggtgc
gggcactgtaagaccctagcacctcactatgttgaggctgcagccaccctagagagcaaa
aacattcctctggctcaagttgactgtacaacggaagaggaactatgtatggagcatggg
atcaggggatacccaaccatcaaggtgttcagaaaccaccaagtcgatgccccatctgat
taccaaggtggaagaactgcaagtgccattgtatcatacatgatcagccaatcgctgcca
ccagtcagtattctggagggcgaggaagctgctgatgacttcaaagacctcttggctgag
tcaagtggagctgtgattgtcgatggtggtgttgagggcttgaacgagactttccacgaa
ctagcagaattgttcagagacgactttacattcgtccaatacaacggttctgatgccaaa
caaaaactctccgtctacttgccaaagcaagatgctcctattgttttcgagggcaagaac
gcatctatctcccacttggtcgactgggttcaggtcgagacaaagccttactttggcgac
attaacggtgaaacgtttcaatcttacatggactccaatgtgcctttggcttacttcttc
tacaccagccctgaggagcgcgcttcttatgaggacttcttctctaagctaggtaaggaa
cacagaggtaagatcaacttcgttggcttagacgcctctgcctttggtagacacgctcag
aatttaaacatgaaggagcagttccctctgtttgtcattcatgacactgtgtccaacttg
aaatatggtttgccacaactttctgaggaggaattttcttccctaaccaagccattggaa
ctgaagacaaaggatattgcgaagttcattaagagctttatttccggaaaagtggagcca
atcattaagtctgaagagatccctgagaagcaagaatctagcgtgttcagaattgtgggt
aagactcacgaagacattatcaacgacgagactagggatgttctggtcaagtactacgcc
ccatggtgtggacactgcaaaaggctggcccctgtttacgaggagttggccaatgtctac
gtcactgacaaagacgctcaagacaaggtcctagtcgccaacgttgacgcaactttgaac
gacgttaacgtcgaccttgagggctaccctactttgattctataccctgctggaaataag
tcaactcctgttgtctaccagggtgccagagatatggagtctctcatgaacttcatccaa
gagaacggtcaccacgaaatcaatggtactgccatcttggaaagcaagaaggctcaggaa
gctaaggaagccgatgaagaagctgaagctattgaagaagagagcgttgaacacgacgaa
ttatag

DBGET integrated database retrieval system