KEGG   Lachancea thermotolerans: KLTH0F01100gHelp
Entry
KLTH0F01100g      CDS       T01117                                 

Definition
(RefSeq) KLTH0F01100p
  KO
K09580  protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
lth  Lachancea thermotolerans
Pathway
lth04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:lth00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    KLTH0F01100g
Enzymes [BR:lth01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     KLTH0F01100g
Chaperones and folding catalysts [BR:lth03110]
 Protein folding catalysts
  Protein disulfide isomerase
   KLTH0F01100g
Membrane trafficking [BR:lth04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    KLTH0F01100g
Exosome [BR:lth04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   KLTH0F01100g
  Exosomal proteins of colorectal cancer cells
   KLTH0F01100g
  Exosomal proteins of bladder cancer cells
   KLTH0F01100g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thioredoxin Thioredoxin_6 Thioredoxin_7 OST3_OST6 Thioredoxin_2 AhpC-TSA Thioredoxin_8 Calsequestrin
Motif
Other DBs
NCBI-GeneID: 8292448
NCBI-ProteinID: XP_002554257
UniProt: C5DK19
Position
F:complement(84685..86250)
Genome map
AA seq 521 aa AA seqDB search
MQLSRNLFLGISALAAALGNAQQEATAPEGSAVVKLTSENFADFIKEHPLVLAEFYAPWC
GHCKTLAPHYVEAAATLESKNIPLAQVDCTTEEELCMEHGIRGYPTIKVFRNHQVDAPSD
YQGGRTASAIVSYMISQSLPPVSILEGEEAADDFKDLLAESSGAVIVDGGVEGLNETFHE
LAELFRDDFTFVQYNGSDAKQKLSVYLPKQDAPIVFEGKNASISHLVDWVQVETKPYFGD
INGETFQSYMDSNVPLAYFFYTSPEERASYEDFFSKLGKEHRGKINFVGLDASAFGRHAQ
NLNMKEQFPLFVIHDTVSNLKYGLPQLSEEEFSSLTKPLELKTKDIAKFIKSFISGKVEP
IIKSEEIPEKQESSVFRIVGKTHEDIINDETRDVLVKYYAPWCGHCKRLAPVYEELANVY
VTDKDAQDKVLVANVDATLNDVNVDLEGYPTLILYPAGNKSTPVVYQGARDMESLMNFIQ
ENGHHEINGTAILESKKAQEAKEADEEAEAIEEESVEHDEL
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgcaattgtccaggaatttgtttctagggatttctgctctggcagctgccctcggtaat
gctcagcaggaggccacggcccctgaaggcagcgcggtcgtcaaattgacatccgagaat
ttcgcagactttattaaagaacatcccttggtattggccgagttctatgcaccatggtgc
gggcactgtaagaccctagcacctcactatgttgaggctgcagccaccctagagagcaaa
aacattcctctggctcaagttgactgtacaacggaagaggaactatgtatggagcatggg
atcaggggatacccaaccatcaaggtgttcagaaaccaccaagtcgatgccccatctgat
taccaaggtggaagaactgcaagtgccattgtatcatacatgatcagccaatcgctgcca
ccagtcagtattctggagggcgaggaagctgctgatgacttcaaagacctcttggctgag
tcaagtggagctgtgattgtcgatggtggtgttgagggcttgaacgagactttccacgaa
ctagcagaattgttcagagacgactttacattcgtccaatacaacggttctgatgccaaa
caaaaactctccgtctacttgccaaagcaagatgctcctattgttttcgagggcaagaac
gcatctatctcccacttggtcgactgggttcaggtcgagacaaagccttactttggcgac
attaacggtgaaacgtttcaatcttacatggactccaatgtgcctttggcttacttcttc
tacaccagccctgaggagcgcgcttcttatgaggacttcttctctaagctaggtaaggaa
cacagaggtaagatcaacttcgttggcttagacgcctctgcctttggtagacacgctcag
aatttaaacatgaaggagcagttccctctgtttgtcattcatgacactgtgtccaacttg
aaatatggtttgccacaactttctgaggaggaattttcttccctaaccaagccattggaa
ctgaagacaaaggatattgcgaagttcattaagagctttatttccggaaaagtggagcca
atcattaagtctgaagagatccctgagaagcaagaatctagcgtgttcagaattgtgggt
aagactcacgaagacattatcaacgacgagactagggatgttctggtcaagtactacgcc
ccatggtgtggacactgcaaaaggctggcccctgtttacgaggagttggccaatgtctac
gtcactgacaaagacgctcaagacaaggtcctagtcgccaacgttgacgcaactttgaac
gacgttaacgtcgaccttgagggctaccctactttgattctataccctgctggaaataag
tcaactcctgttgtctaccagggtgccagagatatggagtctctcatgaacttcatccaa
gagaacggtcaccacgaaatcaatggtactgccatcttggaaagcaagaaggctcaggaa
gctaaggaagccgatgaagaagctgaagctattgaagaagagagcgttgaacacgacgaa
ttatag

DBGET integrated database retrieval system