KEGG   Lachancea thermotolerans: KLTH0F01100gHelp
Entry
KLTH0F01100g      CDS       T01117                                 

Definition
KLTH0F01100p
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
lth  Lachancea thermotolerans
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:lth00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    KLTH0F01100g
Enzymes [BR:lth01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     KLTH0F01100g
Exosome [BR:lth04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   KLTH0F01100g
  Exosomal proteins of colorectal cancer cells
   KLTH0F01100g
  Exosomal proteins of bladder cancer cells
   KLTH0F01100g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
F:complement(84685..86250)
Genome map
AA seq 521 aa AA seqDB search
MQLSRNLFLGISALAAALGNAQQEATAPEGSAVVKLTSENFADFIKEHPLVLAEFYAPWC
GHCKTLAPHYVEAAATLESKNIPLAQVDCTTEEELCMEHGIRGYPTIKVFRNHQVDAPSD
YQGGRTASAIVSYMISQSLPPVSILEGEEAADDFKDLLAESSGAVIVDGGVEGLNETFHE
LAELFRDDFTFVQYNGSDAKQKLSVYLPKQDAPIVFEGKNASISHLVDWVQVETKPYFGD
INGETFQSYMDSNVPLAYFFYTSPEERASYEDFFSKLGKEHRGKINFVGLDASAFGRHAQ
NLNMKEQFPLFVIHDTVSNLKYGLPQLSEEEFSSLTKPLELKTKDIAKFIKSFISGKVEP
IIKSEEIPEKQESSVFRIVGKTHEDIINDETRDVLVKYYAPWCGHCKRLAPVYEELANVY
VTDKDAQDKVLVANVDATLNDVNVDLEGYPTLILYPAGNKSTPVVYQGARDMESLMNFIQ
ENGHHEINGTAILESKKAQEAKEADEEAEAIEEESVEHDEL
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgcaattgtccaggaatttgtttctagggatttctgctctggcagctgccctcggtaat
gctcagcaggaggccacggcccctgaaggcagcgcggtcgtcaaattgacatccgagaat
ttcgcagactttattaaagaacatcccttggtattggccgagttctatgcaccatggtgc
gggcactgtaagaccctagcacctcactatgttgaggctgcagccaccctagagagcaaa
aacattcctctggctcaagttgactgtacaacggaagaggaactatgtatggagcatggg
atcaggggatacccaaccatcaaggtgttcagaaaccaccaagtcgatgccccatctgat
taccaaggtggaagaactgcaagtgccattgtatcatacatgatcagccaatcgctgcca
ccagtcagtattctggagggcgaggaagctgctgatgacttcaaagacctcttggctgag
tcaagtggagctgtgattgtcgatggtggtgttgagggcttgaacgagactttccacgaa
ctagcagaattgttcagagacgactttacattcgtccaatacaacggttctgatgccaaa
caaaaactctccgtctacttgccaaagcaagatgctcctattgttttcgagggcaagaac
gcatctatctcccacttggtcgactgggttcaggtcgagacaaagccttactttggcgac
attaacggtgaaacgtttcaatcttacatggactccaatgtgcctttggcttacttcttc
tacaccagccctgaggagcgcgcttcttatgaggacttcttctctaagctaggtaaggaa
cacagaggtaagatcaacttcgttggcttagacgcctctgcctttggtagacacgctcag
aatttaaacatgaaggagcagttccctctgtttgtcattcatgacactgtgtccaacttg
aaatatggtttgccacaactttctgaggaggaattttcttccctaaccaagccattggaa
ctgaagacaaaggatattgcgaagttcattaagagctttatttccggaaaagtggagcca
atcattaagtctgaagagatccctgagaagcaagaatctagcgtgttcagaattgtgggt
aagactcacgaagacattatcaacgacgagactagggatgttctggtcaagtactacgcc
ccatggtgtggacactgcaaaaggctggcccctgtttacgaggagttggccaatgtctac
gtcactgacaaagacgctcaagacaaggtcctagtcgccaacgttgacgcaactttgaac
gacgttaacgtcgaccttgagggctaccctactttgattctataccctgctggaaataag
tcaactcctgttgtctaccagggtgccagagatatggagtctctcatgaacttcatccaa
gagaacggtcaccacgaaatcaatggtactgccatcttggaaagcaagaaggctcaggaa
gctaaggaagccgatgaagaagctgaagctattgaagaagagagcgttgaacacgacgaa
ttatag

DBGET integrated database retrieval system