KEGG   Lachancea thermotolerans: KLTH0F03674gHelp
Entry
KLTH0F03674g      CDS       T01117                                 

Definition
KLTH0F03674p
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.1.2.15]
Organism
lth  Lachancea thermotolerans
Brite
Enzymes [BR:lth01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     KLTH0F03674g
Peptidases [BR:lth01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   KLTH0F03674g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
F:321662..325258
Genome map
AA seq 1198 aa AA seqDB search
MNDNLAPSNGMVADEGEKKLASVSKDDQLDIMESSSSNDQPDSVKATPPGLPDQMADQSQ
MAEGGAKVDAIPSLVEQRQILSEIYTQAQAESREGDAVYVIPSLWYNNFWDANITEKSRI
GPIDTTSICNDFDNFLLADYNAHPYLSVPETVFKKLSEWYGLSDPSNPVKTVLIKDEDGQ
LVTEYNRCCFRVHFLKDSVEKYNRFSGGVRAPLFFTMSRLSSIEMVVQRCLQKFGEQEKL
FDLKTHRFRIWQVQEPTSTTKSSFLATQYVLDPLTFAEMPIKTRLQSKMFGCLIKNLKLP
VIDLVVELKDVTTGDHWPSNHFYYNKLLPPRGTTGLSNLGNSCYMNSALQCLVHIPELKD
YFLYGGYEEDVNTQNPLGYKGLVAQAFAALIKSLFDERSSSAFAFSPREFKSIIGQQNSM
FAGFLQQDSQEFLAFLLDGLHEDLNRIIEKPFVEKPELSPDEDVNNREVIHRLASKTWDK
HKLRNDSVILDLFVGLYKSTLTCPVCDKTSVTFDPYSDLTLPLPVESIWTSKVRIFPNFS
PPCILEVELPKGSTYQDLKNYVAEVANMNADDLIGAEIFNHAFYNNYESEGSSAKYLPIE
DLISQSDVVAFYEVPRKPDDLVIPVLNSVLEQGFKTARSFGFPFFIALSETELHCYGMIR
KKLEQHYTNWSGGFLNFPIISNDNEVPLDSLGLLKQKYHSVDLSKFKIDIENCSPETSVE
EYFAIKVLSFRNTNNGLTENSMGNQIIWAPGHQVSLSSSQNMMTLMNNVMKDIYDYHTLA
MTQKDEIEELATLSHPADDSKGHESNDEGTKKEETPSDMDVDLNENDSENFPKPDNEPEA
EVDFQRPKFVKEFEAIVCEWNDMSISEVFSDEREISWDKPAELKNEKLEEAKRQRQHEGE
RRISLFDCLKLFSKPEVLSAADSWYCPTCREHRQATKQIQLWNSPDILTIHLKRFESRHS
FSDKISDVVDFPICGLNMSDHLVCEDAEQNNLYDLVAVDNHYGGLGGGHYTAFAKNPVDG
KWYYFDDSRVSETDPETSVSGAAYLLFYRRRVEGPDVGTQRLKNLLASSRQQHQLKLKEF
NDRQVDFYQENHSEPEEELDAQHNFLEASEAESKEGAQENEICNVASLEVGHANSSASCE
ENAGRRKLRLLHKGYANSTANSSHPNSSATSSDSSDCSENISQKFYPAEGAPPTSPLL
NT seq 3597 nt NT seq  +upstreamnt  +downstreamnt
atgaatgacaacctggcaccatctaatggaatggttgccgatgaaggcgagaaaaagctc
gcttcggtttccaaagacgaccaattagacatcatggaaagctcgtcatcgaacgaccaa
cctgactccgtgaaggcaacgccaccaggcctaccagaccagatggctgatcaaagtcag
atggcggaaggcggagctaaggttgatgccattccatctctcgttgagcagcggcaaata
ctatcagaaatatacacgcaagcgcaggcagagagcagagaaggagacgctgtatatgtc
attccttctctttggtacaataacttttgggatgctaatatcaccgaaaaatcccgaatt
gggcccatagacacaacgtctatctgtaacgatttcgacaatttcctgctggcggattat
aacgcgcatccttacctgtcagttccagaaacggtcttcaaaaagcttagcgagtggtat
gggctatcggatccgtcgaaccccgttaaaacggtgctaataaaagatgaagacggtcaa
ctggttaccgaatataatagatgctgctttcgggtccattttctcaaagactctgtagaa
aaatacaacaggttttcaggaggggtacgagcaccgctctttttcactatgtcaaggctg
agctctatagaaatggtagtgcagcggtgtttgcaaaagtttggtgaacaggagaaattg
tttgatttgaagacgcatcgttttaggatatggcaagtacaagaaccaacaagcactacg
aaaagctcgtttttggcaacgcaatatgtcctggatcccttaactttcgcagaaatgcca
atcaagactaggttgcaatcgaaaatgtttggctgcttgatcaagaacttgaagcttccc
gtgatcgacctagttgttgagttgaaggatgttacaaccggtgaccattggccatcgaat
catttctattacaacaagctgttaccaccgaggggaacaaccggactttcaaacttggga
aacagttgttacatgaattctgcgttgcagtgtcttgttcatataccggagcttaaggat
tatttcctgtatggcgggtatgaagaagatgtcaacactcaaaacccactgggttataaa
ggtcttgttgctcaagccttcgccgcgcttataaaatcattgtttgatgaaagatcttct
tcagctttcgcattttctcctagagaatttaaatcaattattggccagcaaaattctatg
tttgccggatttctgcagcaggattcccaagaatttttagcctttctactcgatggcttg
catgaagacctgaacagaatcatagaaaagccgtttgttgaaaagcccgagctttcccca
gatgaagatgtaaacaatagagaagtgattcacagactcgcatcaaagacctgggacaaa
cacaagttgagaaatgattctgttattcttgacctttttgttggattgtacaagtcaaca
cttacatgccctgtctgtgataaaacatctgtgacttttgatccatatagcgacttaact
ttaccacttcctgtggaaagcatatggacatcaaaagtcaggatatttccaaacttctct
cccccttgcatcttggaggtggaactacctaagggctccacgtaccaggatctaaagaat
tacgtggctgaagtggcaaacatgaatgctgatgacttaattggtgcagaaattttcaat
cacgcattttacaacaattatgagtcggaaggctctagcgctaagtatcttcccatcgaa
gatcttatttctcaaagcgatgtagtagctttttatgaagtacctcgcaagccggatgac
ttggtgattccagttttgaattctgtgcttgaacaagggttcaagaccgcacggagcttt
ggttttccgttcttcattgcactttcagagactgaattgcactgctacggcatgataagg
aaaaagctcgagcagcattataccaactggagtggcggcttcctaaatttcccaataata
tcaaatgacaacgaagtgccgcttgattctctaggtctgctcaaacaaaagtaccactca
gtagacctttcaaaattcaaaatagatattgaaaactgttcacctgagacttcggttgaa
gagtattttgcgataaaggttctgagcttccggaataccaacaatggtttaactgaaaat
tctatgggaaaccaaatcatatgggctcctggccaccaggtttctctgagctcctcccag
aatatgatgactttaatgaataacgttatgaaagacatttatgactaccatactctggca
atgactcaaaaagacgagattgaagagctggcaaccttgtctcatcccgcagacgattcc
aaaggtcacgaaagtaacgatgaagggactaagaaagaagagactccttcagacatggac
gttgacctcaacgaaaacgatagcgaaaacttccctaagcccgataatgagccggaggct
gaagtcgacttccaacggccaaaattcgttaaagagtttgaagctatcgtttgcgaatgg
aatgacatgtccatatccgaagtattctcagacgagcgcgaaatttcatgggacaagcct
gctgaactaaagaatgaaaagctggaggaagcgaaacggcaacgtcagcatgaaggagag
agacggattagtctttttgattgcctaaaactgttttcaaaacctgaggtgctaagcgct
gcagattcttggtactgcccaacttgtcgagaacatagacaggctaccaagcagatccaa
ctttggaactcccctgacatcttaactattcacctaaagcggtttgaaagtcgccattcg
ttcagcgacaaaataagcgatgttgtcgactttcctatctgtggccttaatatgtcggac
cacctggtttgtgaagatgccgagcagaacaacctctacgaccttgtagcggttgataac
cactacggtggtcttggcggtggtcactacacagcgttcgccaagaatcccgtggacggc
aagtggtactattttgatgattctcgcgttagtgagacagatcccgaaacctccgtgtca
ggggctgcttatcttttgttttatcgtcgtcgtgtcgagggtccggatgttgggactcag
cggctcaaaaacctgcttgcatcgtcaagacagcagcatcagctaaagctaaaggagttc
aacgataggcaagtcgatttttatcaagaaaatcactctgaaccagaagaagagctcgat
gcgcagcataattttctagaggctagcgaagcggaatctaaagagggtgcccaagaaaat
gaaatttgcaatgttgcaagcctcgaagtgggtcacgctaattctagcgcaagttgtgaa
gagaatgcaggtagaaggaagctgcgattgcttcataaaggttacgccaatagcacggct
aactcctcacaccccaattcttctgcgacgagctctgattcttctgactgcagtgaaaat
atctctcaaaagttctaccccgcagaaggcgccccccctacctcgcctttattgtag

DBGET integrated database retrieval system