KEGG   Lachancea thermotolerans: KLTH0F03696gHelp
Entry
KLTH0F03696g      CDS       T01117                                 

Definition
KLTH0F03696p
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
lth  Lachancea thermotolerans
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:lth00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    KLTH0F03696g
Enzymes [BR:lth01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     KLTH0F03696g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
F:complement(325326..326318)
Genome map
AA seq 330 aa AA seqDB search
MKVYVCGSLNYDLVTFTDRIPDAGETYRANKFETHAGGKGLNQTIAVSKLLSADQGVKVS
MIGHVGDDSFAGELIEILNRNGVDTRLVTALKGVNTGVATIIVEQRTGQNRILISEGANG
HTKFDENHLEVMFPPESQGEGPFYVIFQNEIPGTISAMRWLKQNRPESVIVYNPSPFKDV
ERGDWSLVDLLVVNEIEALQVLESGFGAAVMAEYKSKINVDFVAGYKEVAINLQSKLISG
KSSSFVVITLGEKGCVFASEESQKAQFVEALRVENVIDTTGAGDTFLGGVVSQLCTNHSL
RDSVAFATKASSLSIQRSGAAESIPVHSEI
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtttacgtatgtggctccttgaactacgacttagtaacttttacggatcgtatt
cctgatgcaggtgagacatacagagcgaataagtttgaaacacatgcaggtggaaagggg
ttgaaccagaccatagctgtgtccaaacttttaagcgcagaccagggcgtcaaagtgtca
atgattggacacgtcggcgacgactcgttcgctggtgagctcatcgaaattctcaaccga
aatggggttgatactaggctagtgacagctcttaaaggagttaatacaggggttgctaca
attatcgttgagcaaagaaccgggcagaacaggattcttatctcagaaggagcaaacggg
catactaagttcgacgaaaatcacttggaagtaatgttcccgccagaatcacagggcgaa
ggaccattttatgtgatcttccaaaacgagattcccggcactatttctgctatgcgctgg
ttgaaacaaaatagacctgagagcgtcattgtgtataatccgtctcctttcaaggacgtt
gagcgaggcgactggtccttggttgacctgctggtagttaatgagatcgaggcactccaa
gtcctggagtcgggctttggtgctgcagtaatggctgagtacaagagcaagatcaatgtt
gactttgttgctggttacaaggaggttgcgataaatctacagtcgaaactaatcagcggc
aaatcgtcgagttttgttgtaatcactttgggcgaaaaaggttgtgtgtttgcttctgaa
gagtcacaaaaagcgcagttcgttgaagcacttcgcgtcgaaaacgtaatagacacaact
ggcgcaggggacacttttttgggaggagtcgtttctcagctctgtacaaaccattcgttg
agagatagcgttgcatttgcaacaaaggccagttcactaagcattcaacgtagcggcgcg
gcagaaagtatcccagtgcattctgaaatctag

DBGET integrated database retrieval system