KEGG   Lachancea thermotolerans: KLTH0F04840gHelp
Entry
KLTH0F04840g      CDS       T01117                                 

Definition
(RefSeq) KLTH0F04840p
Organism
lth  Lachancea thermotolerans
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
F:complement(427194..428339)
Genome map
AA seq 381 aa AA seqDB search
MSQSEQRMRETLQELPSGLLGSGSVPETQQQSLPETQQQSSLGQQAVEAKNAQKTELQGR
QTSGKYTLNDFHILRTLGTGSFGRVHLVRSNHNGRFYAMKVLKKRTIVKLKQVEHTNDER
RMLSIVSHPFIIRMWGTFQDAEQVFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCL
ALEYLHAHEIIYRDLKPENVLLDKNGHVKITDFGFAKYVPDVTFTLCGTPDYIAPEVVST
KPYNKSVDWWSFGILIFEMLAGYTPFYDSNTMKTYENILNAQLQFPPFFHADVQDLLSQL
ITRDLSKRLGNLQNGSEDVKNHPWFSEVVWEKLLCRNIETPYEPPVHAGQGDTSQYDRYP
EEENSYGAEGDDPHHDLFAEF
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgtcacagtccgagcagcgcatgcgcgagacgttacaagaactacccagtggccttctt
gggtcgggctccgtgccagagacccagcagcagagcttgccagagacccagcagcagagc
tcgctagggcagcaagcagttgaagcaaaaaatgcacagaagacagagcttcaggggagg
caaacgtcgggcaagtacactttgaatgacttccacatcttgaggacgctggggaccggc
tcgtttgggcgcgtgcacctggtgcggtcgaaccacaacgggcgtttctacgcgatgaag
gtgcttaaaaagcgcaccatcgtcaagctgaagcaggttgagcatacaaacgacgagagg
cgcatgctttcgattgtctcgcacccctttatcatccgcatgtggggtacgttccaagac
gccgaacaggttttcatgatcatggactacatagagggtggcgagcttttctcactgctg
cgcaagtctcagcggttccccaatccagtcgccaagttctacgcggccgaggtctgcctg
gccctcgaatacctgcatgcgcacgagattatctatcgtgacctaaagcccgaaaacgtg
cttctcgacaaaaacgggcacgtcaagatcacagacttcggcttcgccaagtacgtaccg
gacgtcaccttcacgctgtgtggcacgccagactacatcgctcctgaagtcgtgagcacc
aagccctacaacaaatccgtcgactggtggagtttcggcatacttatattcgagatgctg
gctggctacacgccgttctacgactcaaacaccatgaagacctatgaaaacattcttaac
gcccagctacagtttccgcccttcttccatgcagacgtgcaagacctcctgagccagctc
attacgagagacctgagtaagcgactcggtaacttgcaaaatggaagtgaggacgttaaa
aaccacccgtggttcagtgaagtcgtatgggagaaactgctgtgcagaaacatcgaaaca
ccatacgaacctcccgtgcatgcaggccagggcgacacttcgcagtatgatagatatccc
gaggaagagaactcgtatggtgcggagggagatgaccctcaccacgacctctttgcagag
ttctag

DBGET integrated database retrieval system