KEGG   Lachancea thermotolerans: KLTH0F04840gHelp
Entry
KLTH0F04840g      CDS       T01117                                 

Definition
KLTH0F04840p
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
lth  Lachancea thermotolerans
Pathway
Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:lth00001]
 Cellular Processes
  Cell growth and death
   04113 Meiosis - yeast
    KLTH0F04840g
Enzymes [BR:lth01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     KLTH0F04840g
Protein kinases [BR:lth01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   KLTH0F04840g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
F:complement(427194..428339)
Genome map
AA seq 381 aa AA seqDB search
MSQSEQRMRETLQELPSGLLGSGSVPETQQQSLPETQQQSSLGQQAVEAKNAQKTELQGR
QTSGKYTLNDFHILRTLGTGSFGRVHLVRSNHNGRFYAMKVLKKRTIVKLKQVEHTNDER
RMLSIVSHPFIIRMWGTFQDAEQVFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCL
ALEYLHAHEIIYRDLKPENVLLDKNGHVKITDFGFAKYVPDVTFTLCGTPDYIAPEVVST
KPYNKSVDWWSFGILIFEMLAGYTPFYDSNTMKTYENILNAQLQFPPFFHADVQDLLSQL
ITRDLSKRLGNLQNGSEDVKNHPWFSEVVWEKLLCRNIETPYEPPVHAGQGDTSQYDRYP
EEENSYGAEGDDPHHDLFAEF
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgtcacagtccgagcagcgcatgcgcgagacgttacaagaactacccagtggccttctt
gggtcgggctccgtgccagagacccagcagcagagcttgccagagacccagcagcagagc
tcgctagggcagcaagcagttgaagcaaaaaatgcacagaagacagagcttcaggggagg
caaacgtcgggcaagtacactttgaatgacttccacatcttgaggacgctggggaccggc
tcgtttgggcgcgtgcacctggtgcggtcgaaccacaacgggcgtttctacgcgatgaag
gtgcttaaaaagcgcaccatcgtcaagctgaagcaggttgagcatacaaacgacgagagg
cgcatgctttcgattgtctcgcacccctttatcatccgcatgtggggtacgttccaagac
gccgaacaggttttcatgatcatggactacatagagggtggcgagcttttctcactgctg
cgcaagtctcagcggttccccaatccagtcgccaagttctacgcggccgaggtctgcctg
gccctcgaatacctgcatgcgcacgagattatctatcgtgacctaaagcccgaaaacgtg
cttctcgacaaaaacgggcacgtcaagatcacagacttcggcttcgccaagtacgtaccg
gacgtcaccttcacgctgtgtggcacgccagactacatcgctcctgaagtcgtgagcacc
aagccctacaacaaatccgtcgactggtggagtttcggcatacttatattcgagatgctg
gctggctacacgccgttctacgactcaaacaccatgaagacctatgaaaacattcttaac
gcccagctacagtttccgcccttcttccatgcagacgtgcaagacctcctgagccagctc
attacgagagacctgagtaagcgactcggtaacttgcaaaatggaagtgaggacgttaaa
aaccacccgtggttcagtgaagtcgtatgggagaaactgctgtgcagaaacatcgaaaca
ccatacgaacctcccgtgcatgcaggccagggcgacacttcgcagtatgatagatatccc
gaggaagagaactcgtatggtgcggagggagatgaccctcaccacgacctctttgcagag
ttctag

DBGET integrated database retrieval system