KEGG   Lachancea thermotolerans: KLTH0F05170gHelp
Entry
KLTH0F05170g      CDS       T01117                                 

Definition
KLTH0F05170p
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
lth  Lachancea thermotolerans
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
F:456433..457476
Genome map
AA seq 347 aa AA seqDB search
MSAFGATFTRTFNKRSLALLAGVTAAAGSAVAFQNYQSSNNGNGFGRSSKLWGTLSAGTA
LHVAEAQKKPEDYQKVYNAIALKLRDEDEYDNYIGYGPVLVRLAWHISGTWEKDDNSGGS
FGGTYRFKKEMDDPSNKGLQNGFKFLKSIHEKFPWISHGDLFTLAGVTAIQEMQGPKIPW
RAGRVDQKEDTTPDNGRLPDASRDANYVRNFFKRMNFDDREVVALLGAHALGKTHYKNSG
FEGPWGAATNVFSNEYYVNLLNEKWKKVKNDEGNIQYDSDKGYMMLPTDMALVQDPKYLK
IVKEYANNQDTFFNDFTKVFTKLIQNGIEFPKEIKATTFKTLDEQDI
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcattcggagctacatttactagaacattcaacaaaagatcgctcgcgcttctc
gccggcgtcaccgcggcggcgggctcggctgtcgccttccagaactaccaatctagcaac
aacggcaatgggttcgggcgcagctctaagctgtggggaaccctcagcgcgggaaccgca
ctgcacgttgcagaagctcagaagaaacccgaagactaccagaaggtctacaacgcaatt
gcgctgaaattaagggacgaggacgagtacgacaactacatcggttacgggccagttctg
gttcgtctcgcgtggcacatctccggtacctgggagaaggacgacaactctggcgggtct
ttcggcggaacctacagattcaagaaagagatggacgacccctccaacaagggccttcaa
aacgggttcaagttcctgaagtccatccatgagaagttcccttggatctcgcacggtgac
ctgttcaccctggctggtgtgactgccatccaagagatgcagggtcctaagatcccatgg
agagccggcagagttgaccagaaagaagacacaaccccagacaacggcagactacccgac
gccagcagagacgccaattacgtacgcaattttttcaagagaatgaactttgacgaccgc
gaagtggttgctctgctcggtgcacacgctctaggaaagacccactacaaaaactctgga
ttcgaaggcccttggggtgcggccaccaacgtattttccaacgagtactacgtgaacctg
ctcaacgagaaatggaagaaagttaagaacgacgagggcaacattcagtacgacagcgac
aagggctacatgatgcttccaacagacatggccttggtgcaggaccctaagtacttgaag
atcgtcaaggaatacgccaacaaccaggacacttttttcaatgactttacgaaggtgttc
accaagctgatccagaatggtatcgagttcccaaaggagatcaaggctaccaccttcaag
actttggacgagcaagacatctaa

DBGET integrated database retrieval system