KEGG   Lachancea thermotolerans: KLTH0F05522gHelp
Entry
KLTH0F05522g      CDS       T01117                                 

Definition
KLTH0F05522p
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
lth  Lachancea thermotolerans
Brite
Enzymes [BR:lth01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     KLTH0F05522g
Protein kinases [BR:lth01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [Table]
   KLTH0F05522g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
F:complement(477035..478975)
Genome map
AA seq 646 aa AA seqDB search
MPESDKSIWNPAFLNNAQKQQGAPSYGFKNPWHDVSGATGKRNSMQFNQHLPTTYEEAPQ
HGSASENGFRRRNSSLIVPPPRAAGPAPDAYMYGMQFVPQQGYPGNSQELHRRQSVAVAP
QHSFAQPALPADMSMHAPMSPFHRKLSSYPATAGSVLPPPVKQMRRQDEMIPVVLPQMHK
VNARQDMRPTINATPKYRRASLDSRTVSPLVALTKSLTTTYTLCSPEFSYQTSKNPKRVL
TKPSEGKNNNGHDNINSDYILYVNDVLGTEQNRKYLVLDILGQGTFGQVVKCQNMLTKEI
LAVKVVKSKSEYLNQSITEAKILELLNSKIDPLGEHHFLRMHETFVHRNHLCLVFELLSS
NLYELLKQNQFHGLSISLIRSFARQLLDSLSVLKDNKLIHCDLKPENILLVSLDRPELKV
IDFGSACEETRTLYTYIQSRFYRAPEVILGIPYSTGIDMWSLGCIIAELFLGIPIFPGSS
EFNQITRVVDTLGLPPAWMLDMGRNTSNFMIKDEAGGKTWKVKSVEEYNMDFGSDEQPGK
QYFKWRKLDDIIQNYRISKKIAGAPALVEKERQERVCLTHFLHGLLNINPLERWTPTQAA
MHPFITQQPFSGEWFPPGSTPRRTAKTPVLQERSTTSEIDKLHIAD
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atgccagagtctgataaaagcatttggaaccctgcttttctgaataatgctcagaagcag
cagggtgcgccttcgtacgggttcaagaatccctggcacgacgtatccggcgcaacgggt
aagcgcaattcgatgcagtttaaccagcatctacctacgacctacgaggaagcgccgcag
cacggcagtgcaagtgagaatggttttcggcggcgtaactcgagtctaatcgtcccaccg
cccagagcggccgggccagcccccgacgcatatatgtatgggatgcagtttgtaccgcag
caaggatacccgggcaactcgcaggagctgcacaggcggcagtcggtggcagtagcgccg
cagcactccttcgcgcagccagcgctgcctgccgacatgtcgatgcacgctcccatgtcg
ccgtttcatcgcaaactcagctcataccccgcgaccgccggatcagtgctaccacctcct
gtgaaacagatgcggaggcaggacgaaatgatcccggtggtgctgccgcagatgcataag
gtcaacgcaaggcaggatatgcggcccacaataaacgcaacccccaagtaccgccgtgcg
tcgctggattctcggacagtctcgccgctggttgccttgaccaaatcgctcaccactact
tacacgctatgctctccagaattctcgtaccagacctccaaaaaccccaagcgcgtgtta
acgaagcccagcgagggcaagaacaacaacgggcacgacaatatcaatagtgactacatt
ctttatgttaacgatgtgctgggcacggaacagaaccgcaagtaccttgtgcttgacatt
ttggggcagggcacgtttggccaggtggtgaaatgccagaacatgctcaccaaggaaata
ttggcggttaaagtggtcaagtcgaaaagtgagtatctcaaccagagcattacggaggcc
aagatcctggagctgctgaatagtaagatagaccctctaggggagcaccactttctacgc
atgcatgaaacgtttgttcacaggaaccacctgtgtctggtttttgagcttttaagcagc
aacttgtacgagctgctgaagcagaaccagttccacgggctctctataagcttgataaga
tcgtttgcacgccaactgctggactcgctgagcgtgctgaaagacaacaagctgattcac
tgcgacttgaagccggagaacatcctgctggtatcgttagacaggcccgagctcaaagtg
atcgacttcggctccgcctgtgaagagacaaggactctttacacgtacatccagtcgaga
ttctaccgtgcgcccgaggttatcctggggatcccgtactcgaccgggatcgacatgtgg
tcgctgggctgcataatcgcggagcttttcctaggtattcctatttttccaggctcttcg
gaattcaaccaaatcacgagagtagtcgacacgctaggtctgcctccagcttggatgctc
gacatgggaaggaacaccagcaattttatgataaaggatgaagctggcggcaaaacctgg
aaagtcaagagtgtcgaggagtacaatatggacttcggttcggacgagcagccagggaag
caatactttaaatggagaaagctggatgacatcatccagaattaccgcatttccaagaag
attgcaggagctcccgcgctagtcgaaaaggagaggcaggagcgcgtgtgtctgactcat
tttctgcatggcctgctgaacatcaacccgctggagcggtggacgcctactcaggcggcc
atgcacccatttatcacacaacagccgttctcaggagaatggttcccgccaggttcaacc
ccaagaagaaccgccaaaacaccggtgctccaggagcgaagcaccacctccgagatagac
aaactccacatcgccgactaa

DBGET integrated database retrieval system