KEGG   Lachancea thermotolerans: KLTH0F05918gHelp
Entry
KLTH0F05918g      CDS       T01117                                 

Definition
KLTH0F05918p
Orthology
K11227  
mitogen-activated protein kinase kinase [EC:2.7.12.2]
Organism
lth  Lachancea thermotolerans
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:lth00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    KLTH0F05918g
Enzymes [BR:lth01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     KLTH0F05918g
Protein kinases [BR:lth01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   KLTH0F05918g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
F:complement(525566..527254)
Genome map
AA seq 562 aa AA seqDB search
MGGLEPSNGDHEIKRTGSTSSNYSNINANLHARVKAFQEQRQLKRNGSVGSGHGSVSSQS
GKTEGGGEPQNIDKIVNKPLPPLPPSKESGQVLSPIRRAPRPPALSAAGPGGGAAKPSLS
ARRGLKLPAGGMSLKMKPPAPQEFAGAPSNRNPAVATPGVATAQNGRRSNPGSLVNGVQT
TSTSSRQQRDTEGTTPSQQQLQQQQSRSGSNGLFTNFSKYVDIKSGSLNFAGKLSLSSQG
VDFSNGSSFRITLDELEFLEELGHGNYGNVSKVLHKPTNVIMAMKEVRLELDESKFTQIL
MELEVLHKCQSPFIVDFYGAFFIEGAVYMCMEYMDGGSLDKSYDSEYLGGIDEPQLAHIT
YAIIQGLKELKDVHNIIHRDVKPTNVLCSAAQGTVKLCDFGVSGNLVASLAKTNIGCQSY
MAPERIKSLNPDKATYTVQSDIWSLGLSILEMAIGSYPYPVETFDNIFSQLSAIVDSPPP
KLPQDRFSPVAQDFVNMCLQKVPERRRNYAALLEHPWLKRYSNIEVNMSEYITNRLEKKR
LITEEKGSEPVKNIPALHKGGL
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atggggggactagagccttcaaacggggaccatgagatcaagagaaccggctcgacgtct
tccaattacagcaatatcaatgctaatctccatgctcgcgtaaaagcgttccaggaacaa
aggcaactgaaacggaacggcagcgtgggatcggggcatggaagcgtttccagtcaatcg
gggaagacagaaggtggcggtgagcctcagaacattgacaagatcgttaacaagccattg
ccgccgctccctccaagcaaggaaagcggacaggtgcttagccccattcggagagcgcca
aggccgcccgcgctctcagcagcagggcctggaggcggagcggctaaaccgagcttgagc
gccaggagaggcctcaagctgcccgcaggcgggatgtcgctcaaaatgaagccacctgcg
cctcaagagttcgcgggggccccttcgaatcgcaatccggctgtcgccacccccggcgtg
gcgacagcgcagaacgggcgccgcagtaatcccgggtcgctcgtcaacggcgtacaaaca
acgtcgacgtcttccaggcagcagagggacactgaaggaaccacgccatctcagcagcag
ctccagcaacagcaaagtcgcagtggttccaacggtttattcacaaatttctcgaaatat
gtcgacatcaagtcgggatccctgaatttcgcgggaaagctgtcattgagctcgcagggc
gttgatttcagcaatggatctagtttccggattacgctggacgagctagagttcctcgag
gaactgggccacgggaactacgggaatgtctccaaggtccttcataaacccacaaatgtg
atcatggcaatgaaggaggtgcggctcgagctggatgagtccaagtttacgcaaattctt
atggagctggaagtactacacaagtgccagtcgccgttcatcgtggatttttacggtgcc
ttcttcatcgaaggtgctgtgtacatgtgcatggagtacatggatggtggatcattggat
aaaagttacgacagcgaataccttggaggtattgacgagccccagctagcccacatcacc
tacgctatcatccaagggctcaaggagctcaaagacgtgcataacatcatacaccgggac
gtcaagccaactaacgtgctgtgttccgcagcgcagggaaccgtgaaactctgtgacttt
ggtgtttcaggtaaccttgttgcatccctggccaaaactaacatagggtgccagtcatac
atggctcctgaacgaattaagtccctgaacccagataaagctacttacaccgttcagtct
gacatttggtctttggggctcagcattctggaaatggcgatcggctcatacccctaccca
gtagagacttttgacaacatattctcacagctgagcgcgatagtcgattcaccacctccc
aaactgccacaagatcgttttagccccgtagcgcaagatttcgttaatatgtgcttgcag
aaagttcccgaaagaagacgaaattacgctgcgctcctagaacacccttggctaaaaaga
tacagtaacatcgaggtaaacatgagcgagtatataaccaaccgtctggagaagaagcgc
ctgatcacagaagagaagggctctgaacctgtgaagaacatccctgctcttcataaaggt
ggactttaa

DBGET integrated database retrieval system