KEGG   Lachancea thermotolerans: KLTH0F06468gHelp
Entry
KLTH0F06468g      CDS       T01117                                 

Definition
KLTH0F06468p
Orthology
K08866  
serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
lth  Lachancea thermotolerans
Pathway
Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:lth00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    KLTH0F06468g
Enzymes [BR:lth01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     KLTH0F06468g
Protein kinases [BR:lth01001]
 Serine/threonine protein kinases: Other group
  TTK family
   KLTH0F06468g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
F:559256..561769
Genome map
AA seq 837 aa AA seqDB search
MSSYTVRSSVPGAPSNRRLEFPARRTSVQSLARDDSDDENMLGPPKLSNFGSALLSDKEN
VEPYPYSRNQSVSNAKRYSQPPRAAARPETFGAVREFSSSNTNNSVAGPYSTFHSEEHSD
STMFATSKHNQQSMTTFNPETPSEQGKPEDMYLEKSRSRVKSMQQTLRDELSLRSSKRRN
RRFVSSRFNLLGPAKRASSNTGTPNHSELADESNVSQQEANFSHSSSAGATAHQNEYNVF
YESQNSSSPQKDSAAPTDHTSINYDNIEFGDLNPYQYLKKHNIPTTELPNISRLYFERQK
GENRKTALRKNIAAKDAFQTRLTSASLSNSPLLKHVDLIKREQSIPKRQPRRKISDHATN
NDSKAWSSPVSSSKGLKTAPSRDGTSPRASEMYENIERPERDTFGSIRRREALSNININS
NYHQLQNKRTKYSTENLEEARGIHRPPFEHSVQEERFANHGFKHRSPPAVPERKHVEIVE
PLKTTESIPLKPPATSGDSYNRRKPTIYVNGTEYEKLELLGRGGSSKVYKVKNVANNKVY
ALKRVSFDEFDDSSIEGFKGEIELLKKLETKPRVVKLIDHEMDHGVLYEVMECGDHDLSH
TLALRSGMGLDVEFVRFHSQEMLKCVKVVHDSGIVHSDLKPANFVFVKGILKIIDFGIAN
AVPEHTVNIYRETQIGTPNYMAPEALVAMNYTQGQPAEQNRWKVGKPSDIWSCGCIIYQM
IYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSV
DEVLNGPFVKPIAVTHFFIRDLIKNSVKYGANQREISNEKIEELAEDVWHRLADFRL
NT seq 2514 nt NT seq  +upstreamnt  +downstreamnt
atgtccagctatactgtgagatcttccgttcctggtgcaccgagcaacaggaggctggag
ttcccggcgcgaaggacatctgtacagagcctggctcgggacgattcggacgacgagaac
atgctgggtccgcctaaactgagcaacttcggttcagcccttctttctgacaaagaaaac
gtcgagccgtacccatactctcggaatcaaagcgtctcaaacgcaaaaaggtacagccaa
ccgcctcgggctgcagcgcggcctgaaactttcggcgcggttagagagttctcttctagc
aacaccaacaatagcgttgcaggcccgtactcaactttccattctgaggagcactctgac
tctaccatgtttgccacttcaaaacacaaccagcaaagcatgacaacgttcaatcccgaa
acgccgtcagaacaaggcaaacccgaggacatgtacctagaaaaaagccggtcaagagtc
aagagcatgcagcagacactgagagatgagctttccttaaggagctcgaaacgccgaaat
agaaggtttgtctcttctaggttcaacctgcttggtcccgcaaaaagagcgtcctctaat
acaggcacccccaatcatagcgaacttgctgacgaatccaacgtgtcccagcaggaggct
aatttttcccactcatcgagcgccggcgctactgctcaccaaaacgagtataacgtgttt
tatgaatcgcaaaattccagctccccacagaaagacagcgcggctcctactgaccacaca
agcattaattatgataatattgaattcggggacttgaatccatatcaatatctcaaaaag
cacaatattccaactaccgagctgccgaacatctcgaggctttattttgaacggcagaag
ggcgaaaacaggaaaacagctcttcgcaaaaacatcgccgctaaagacgcctttcaaaca
agattgacgtctgcttcactttcaaactcgccccttctgaaacacgttgacctcatcaaa
cgtgagcaatctataccgaagcggcaacctcgaagaaaaattagtgaccatgccacaaat
aacgactccaaagcgtggtcttcacccgtctctagctcgaaaggtctgaagacagctcct
agtcgggatggaacaagtccaagggcaagtgaaatgtatgaaaatatagagagacccgag
cgcgatacatttggatctatcagaaggcgagaagccctttctaacatcaacatcaacagc
aattaccaccaacttcaaaataaaagaacaaagtactcgactgagaacttagaagaagca
agagggattcacaggcctccattcgaacattcagtccaagaagagcggtttgcgaatcat
ggtttcaagcatcgcagcccgcctgctgttcccgaaaggaagcacgttgagattgttgag
cccttgaaaacgacagaaagtattcctctcaagccacctgctacaagtggtgacagttac
aacagaagaaaaccaacgatttatgtcaacggtacagagtacgaaaagctggagcttttg
ggaaggggtggatcatcaaaagtctacaaggtcaaaaatgttgcaaacaataaagtctat
gcacttaaaagggtgtcatttgatgagtttgatgacagcagcatcgaggggtttaaaggt
gaaattgagctactgaaaaagttggaaacaaaaccgcgagtagtgaagctcatcgatcat
gagatggatcacggagttttgtatgaagtcatggaatgtggagaccacgacctgtcgcac
actttagccttaaggtcgggaatgggtctggacgtcgaatttgtgagatttcactctcaa
gagatgctaaaatgcgttaaggtggtgcacgactcaggaatagtgcactccgatctgaaa
cccgcaaatttcgtctttgtgaaggggatcttgaaaatcatcgactttgggatcgcaaac
gcagtaccagaacacacagtgaatatttacagagaaacccaaatcggaacgccgaactac
atggcgcctgaagctcttgttgctatgaattacacccagggtcagccggctgaacagaat
agatggaaagtcggtaagccttcggacatttggtcttgcgggtgtataatatatcagatg
atatatggtaggccaccctacggtggattccaaggccaaaataggttactcgcaatcatg
aatccggaggttaaaattgtttatcccgagaaaacttcgaacggggacgtggttccaaaa
actgcgattgatacaatgaaagcctgtttagaaaggaatcctgaaaagcgctggtccgtt
gatgaagttttgaatggcccatttgttaagcctattgcggtgacacactttttcatacgg
gacctgatcaaaaactccgtgaagtacggtgctaaccagagagagatttccaacgagaaa
atcgaggagttggctgaagatgtttggcatagattagcagattttaggctgtga

DBGET integrated database retrieval system