KEGG   Lachancea thermotolerans: KLTH0F06688gHelp
Entry
KLTH0F06688g      CDS       T01117                                 

Definition
KLTH0F06688p
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
lth  Lachancea thermotolerans
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:lth00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    KLTH0F06688g
   01230 Biosynthesis of amino acids
    KLTH0F06688g
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KLTH0F06688g
  Energy metabolism
   00680 Methane metabolism
    KLTH0F06688g
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    KLTH0F06688g
Enzymes [BR:lth01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     KLTH0F06688g
Exosome [BR:lth04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   KLTH0F06688g
  Exosomal proteins of melanoma cells
   KLTH0F06688g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
F:583833..584738
Genome map
AA seq 301 aa AA seqDB search
MTGSDTYKLFVLRHGQSELNHENIFCGWIDAGLTEKGKAQAKNAAALIKVHCMANSLEPP
KIGYTSRLVRTQQTIEVMLEELNIKPNYRVVTKSTNVDKILREEWSREEALVLQTWRLNE
RHYGAWQGQRKPTILQEYGKEQYMFIRRDYNGRPPAADLSREMVQEVDDKGSLTGYDFKE
PNRRVKYNLEEHSGETLPNNESLSDVVERLDGFLNQIILKNLDYCSSGLVVAHGSSVRSI
LKIIEGISDTDIKDVEIPNAIPLVIELDRHTKMFVRKYYLDPELAKINAEKVRNEGFEKR
D
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgacaggatcagatacgtacaagctatttgttctaagacatggtcaaagcgagctgaac
catgaaaacatcttctgcggttggatcgatgctggcctcacagaaaaaggtaaagcgcaa
gccaagaatgcagcggcgctaataaaagtccactgcatggcgaattcccttgagccacct
aagatcggatatacttcaaggctggttaggacacagcaaacgatcgaagtaatgcttgaa
gagctcaacatcaaacccaactacagggttgtaacaaagtcgaccaatgttgacaaaatt
ttgagggaggaatggagtcgtgaagaggctttggttttgcagacgtggagattgaacgag
cgtcattatggggcctggcagggccaaagaaaacccaccatcttgcaggaatacggcaaa
gaacaatatatgtttatcagaagagactacaacggtaggccccctgctgcggacttgagc
agggaaatggtccaggaggtcgatgacaagggctccttgacaggttacgactttaaggaa
cctaacagaagagttaagtacaatcttgaagaacattctggcgaaacgcttccaaacaac
gagtctctcagtgatgtggttgagcggctcgatggcttcttaaaccagatcattttgaaa
aatctggactactgctcgtcagggctcgttgtggctcacggaagttcagttcgctcaata
ctgaaaatcatcgagggaatctccgacactgacattaaagatgtggaaatccctaacgca
atccctcttgtaatcgaattggacaggcacaccaagatgtttgtacgcaagtattatctg
gatcccgaactcgccaagatcaacgcagaaaaggtccgcaacgaggggtttgaaaagcgt
gactaa

DBGET integrated database retrieval system