KEGG   Lachancea thermotolerans: KLTH0F07326gHelp
Entry
KLTH0F07326g      CDS       T01117                                 

Definition
(RefSeq) KLTH0F07326p
  KO
K00728  dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
lth  Lachancea thermotolerans
Pathway
lth00514  Other types of O-glycan biosynthesis
lth00515  Mannose type O-glycan biosynthesis
lth01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lth00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00515 Mannose type O-glycan biosyntheis
    KLTH0F07326g
   00514 Other types of O-glycan biosynthesis
    KLTH0F07326g
Enzymes [BR:lth01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose---protein mannosyltransferase
     KLTH0F07326g
Glycosyltransferases [BR:lth01003]
 O-Glycan biosynthesis
  O-linked Man type
   KLTH0F07326g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MIR PMT Ins145_P3_rec
Motif
Other DBs
NCBI-GeneID: 8292725
NCBI-ProteinID: XP_002554522
UniProt: C5DKT4
Position
F:complement(635723..637696)
Genome map
AA seq 657 aa AA seqDB search
MWPGVVKRGPFRPYISYDVPDPSYGAKIERVDVIYAVILGISFVLKQLAAFDSSAQQTPM
EKDLMESVNHFKEKNFFLMSFPPLVVEIIGLFASTTGSVSIALLRRANLAIAALTVSAFY
LALRKSDIVRVVAMVAAAGLSHLPLFAEESLHLSLNVPQLALLSCCLLSWNSFKRSQAFS
RGWYWSLTMLSTFLAFASSIKFVGVVTWSWFIILIIKQLWEIVGDVNISTCKILRHTAWR
FAAVVFVPFAFLVSTYFLLISNSRGASLDHSSLVSPYFKSWFLPQPMPQPDVVYYGSSIL
IRHAQSLGGYLHSHNHTYETGSQEQQVTLVDFSNNGDNEWIIEPSDQNLNAEKQLEPVKN
GAVIRLRHKSTGKLLRSSSAKAPVSEQDYDHEVSCTGDNDYKGDSDESWRLRFERGKTPH
DGLLCPFTIYFSLENEGQSCKLLSHDQRLPDWGFGQQEVLCVDSASKERSLFFIDRSNLY
KERGAYLTYPKQSKLKRLWNLSREYIKRQYKYDYYLKNKDVTEGVSAENWIWNSFDSVTV
NFIWFIPLGCVAMYVMTEITRWITWNPWAAATPELESEKRCYLDSCLELSIGWFMHYQIF
TWSKHQNLTLAQYLPSYLLSLLVAAHTANYVWRHSKLGRLALVLFALSAGALTLQWA
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
atgtggcctggggtggtaaaacgtggtccattcagaccatacattagctacgacgtgcct
gacccgtcttacggggctaagattgagcgagttgatgttatctacgcggtaattttgggg
atctcatttgtgctcaagcagcttgcggccttcgattcttcagcgcaacagacgcccatg
gagaaagacctgatggagtccgtcaaccactttaaggaaaagaatttctttctcatgtcg
ttcccgcctttggtggttgagatcattgggctgtttgcgtcaacgacgggatcagtttcc
attgcgctcctcagaagggcaaatctggccattgctgccctaaccgtgtcagctttctac
cttgcactaagaaaatcagatattgtccgtgttgttgcgatggtcgcggctgccgggcta
tcgcacttgccgttatttgcagaagagagtctacatctctctttaaatgtcccgcaactt
gccctgctatcctgctgcttgctgagttggaattcattcaagcgctctcaagcgtttagt
cggggctggtattggagccttacaatgttgtctacatttttggcttttgccagctccata
aagttcgtgggggtagttacgtggagctggttcatcattctgattatcaagcagctttgg
gaaatagtaggtgatgtgaatatctcaacatgcaagatactgcggcacactgcatggaga
tttgcggctgttgtttttgttcccttcgcatttttggtttcaacttactttctgctgatt
tccaactctcgtggtgcgtccctagaccactcaagcttagtttctccgtacttcaaaagc
tggttcttgccacagccaatgccacagccggacgttgtttattatggcagcagtattctg
atccgccatgctcagtcgcttggtgggtacttacactcacacaaccacacatatgaaact
ggatcacaagagcagcaggtcacactggtcgatttctctaacaacggtgacaatgagtgg
attatcgagccttctgatcagaacttgaatgccgaaaagcaactagaaccagtcaaaaac
ggagcagtcataagacttagacataagtccactggcaaattgttaagatcttcttctgca
aaagcgccagttagtgagcaagattatgatcacgaagtgtcgtgcaccggggacaacgac
tacaaaggggattcagatgaatcttggaggttgagattcgagcgtggaaagacccctcac
gatggattactgtgtcctttcactatttacttcagcttagagaatgaaggtcaaagttgt
aagctcttaagccatgatcaaaggctaccagattggggctttgggcaacaagaagtcttg
tgcgtggattctgcctctaaagaacgctcgcttttctttatcgacagatcgaacctttac
aaagaaagaggtgcatacttaacctatccaaagcagtcgaagctcaagagactttggaat
ttgagcagagaatacattaaaaggcagtacaaatacgactactatttgaaaaacaaagat
gtcactgagggagttagcgcagagaactggatttggaactcgttcgactccgttactgtg
aacttcatttggtttatacctctcggttgcgtggcgatgtatgtgatgacagaaattaca
cggtggatcacttggaacccgtgggctgctgcgactccagagctcgagtccgaaaagcgt
tgctacttagatagttgcttggaactttccatcggatggttcatgcactaccaaattttc
acgtggagtaagcaccaaaacctcacgctcgcgcagtatcttccaagctacctgctcagc
ctgttggtcgcagcgcataccgcgaactatgtctggaggcacagtaaattagggcgcctg
gccctggttctgttcgcgctctctgccggagctttgacattacagtgggcttga

DBGET integrated database retrieval system