KEGG   Lachancea thermotolerans: KLTH0F09504gHelp
Entry
KLTH0F09504g      CDS       T01117                                 

Definition
KLTH0F09504p
Orthology
K02202  
cyclin-dependent kinase 7 [EC:2.7.11.22 2.7.11.23]
Organism
lth  Lachancea thermotolerans
Pathway
Basal transcription factors
Nucleotide excision repair
Class
Genetic Information Processing; Transcription; Basal transcription factors [PATH:lth03022]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:lth03420]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
F:join(824743..824770,824831..825729)
Genome map
AA seq 308 aa AA seqDB search
MISQAEYSKEKKVGEGTYAVVYVGTKQSSNRKVAIKEIKTSGFKDGLDMSAIREVKYLQE
MQHINVIELIDVYMAQSNLNLVLEFLPADLEMIIKDTAILFTQADIKSWLLMTLRGVHHC
HRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQDFLTSNVVTRWYRAPELLFGAR
HYTGAIDMWSVGVIFAELMLRIPYLPGKDDIDQIDVTFRALGTPTDKDWPEISTFGTYNK
IQFYPPPSREELRRRFIAATENALDLMSGMLIMNPHKRWDPIQCLTNQYFVELPEPTTPA
DLPQLNKK
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgatatcacaagcagagtattctaaagagaaaaaggtcggagaaggtacttatgccgtt
gtctatgtcggcactaagcaatcgagcaaccgaaaagtagcaatcaaagaaatcaagacc
tcgggattcaaagatggcttggatatgtcggccattagggaggtcaaatacctacaagag
atgcagcatatcaatgtcattgaactaatagatgtttacatggctcaaagcaacctaaat
ttggtattagagtttcttccggcagatttagagatgattatcaaggataccgctattcta
ttcactcaagccgatataaagtcttggcttctcatgacgttgagaggcgtacaccactgt
catagaaacttcatcctgcaccgagacctgaaacccaataatcttctgctggcaccagat
ggccagcttaagttggctgactttggactggcaaggaacatggggtcacctcaagacttt
ctaactagtaatgtggtaacaagatggtatagggcaccagaactgctattcggcgccaga
cattatacaggggcgatcgatatgtggtctgtgggcgtaatttttgcggagcttatgctg
agaataccttacctgcctggcaaagatgacattgatcaaattgatgttactttcagagcc
ctaggaacgccaacagataaggattggcctgaaatctcgacttttggtacttacaacaag
attcaattttatccaccaccttcaagagaagaactgaggagacgctttatagcggcaaca
gagaacgctcttgacttgatgagcggcatgttaataatgaatcctcacaagagatgggat
cctattcagtgcctgacaaaccaatattttgtggagcttcctgaacctaccacaccagct
gacttaccccagttaaacaagaaataa

DBGET integrated database retrieval system