KEGG   Lachancea thermotolerans: KLTH0F09504gHelp
Entry
KLTH0F09504g      CDS       T01117                                 

Definition
KLTH0F09504p
Orthology
K02202  
cyclin-dependent kinase 7 [EC:2.7.11.22 2.7.11.23]
Organism
lth  Lachancea thermotolerans
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:lth00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    KLTH0F09504g
  Replication and repair
   03420 Nucleotide excision repair
    KLTH0F09504g
Enzymes [BR:lth01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     KLTH0F09504g
    2.7.11.23  [RNA-polymerase]-subunit kinase
     KLTH0F09504g
Protein kinases [BR:lth01001]
 Serine/threonine protein kinases: CMGC group
  CDK family
   KLTH0F09504g
Transcription machinery [BR:lth03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     KLTH0F09504g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
F:join(824743..824770,824831..825729)
Genome map
AA seq 308 aa AA seqDB search
MISQAEYSKEKKVGEGTYAVVYVGTKQSSNRKVAIKEIKTSGFKDGLDMSAIREVKYLQE
MQHINVIELIDVYMAQSNLNLVLEFLPADLEMIIKDTAILFTQADIKSWLLMTLRGVHHC
HRNFILHRDLKPNNLLLAPDGQLKLADFGLARNMGSPQDFLTSNVVTRWYRAPELLFGAR
HYTGAIDMWSVGVIFAELMLRIPYLPGKDDIDQIDVTFRALGTPTDKDWPEISTFGTYNK
IQFYPPPSREELRRRFIAATENALDLMSGMLIMNPHKRWDPIQCLTNQYFVELPEPTTPA
DLPQLNKK
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgatatcacaagcagagtattctaaagagaaaaaggtcggagaaggtacttatgccgtt
gtctatgtcggcactaagcaatcgagcaaccgaaaagtagcaatcaaagaaatcaagacc
tcgggattcaaagatggcttggatatgtcggccattagggaggtcaaatacctacaagag
atgcagcatatcaatgtcattgaactaatagatgtttacatggctcaaagcaacctaaat
ttggtattagagtttcttccggcagatttagagatgattatcaaggataccgctattcta
ttcactcaagccgatataaagtcttggcttctcatgacgttgagaggcgtacaccactgt
catagaaacttcatcctgcaccgagacctgaaacccaataatcttctgctggcaccagat
ggccagcttaagttggctgactttggactggcaaggaacatggggtcacctcaagacttt
ctaactagtaatgtggtaacaagatggtatagggcaccagaactgctattcggcgccaga
cattatacaggggcgatcgatatgtggtctgtgggcgtaatttttgcggagcttatgctg
agaataccttacctgcctggcaaagatgacattgatcaaattgatgttactttcagagcc
ctaggaacgccaacagataaggattggcctgaaatctcgacttttggtacttacaacaag
attcaattttatccaccaccttcaagagaagaactgaggagacgctttatagcggcaaca
gagaacgctcttgacttgatgagcggcatgttaataatgaatcctcacaagagatgggat
cctattcagtgcctgacaaaccaatattttgtggagcttcctgaacctaccacaccagct
gacttaccccagttaaacaagaaataa

DBGET integrated database retrieval system