KEGG   Lachancea thermotolerans: KLTH0F10252gHelp
Entry
KLTH0F10252g      CDS       T01117                                 

Definition
KLTH0F10252p
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
lth  Lachancea thermotolerans
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:lth00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    KLTH0F10252g
Enzymes [BR:lth01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose-protein mannosyltransferase
     KLTH0F10252g
Glycosyltransferases [BR:lth01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   KLTH0F10252g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
F:882483..884990
Genome map
AA seq 835 aa AA seqDB search
MPPKAYSESQGTGSQDPVPDLNIGKGPERPYVVTEPPSSLVESRTPKSAKEKLTIAVLLL
VTAFVRLYGLSYPNSVVFDEVHFGGFASKYIKGVFFMDVHPPLAKMLFAAIGSIAGFTGD
FDFESIGQMFPATTPYFFMRLFPAVLGTLTVLLMYMTLRCSGVRVPIAFIASLCFAVENS
YVTISRYILLDAPLLFFIASAVYSFKKYEIYPQGSWNSQKALLSTGLALGMALSAKWVGL
FTIAWVGILCVWRLWFMIGDLSKPIRKTVREAVRKFSFLLVIPLVIYVFFFYVHFKCLTI
HSDGAGFFSSAFRTTLQGNTIPQNILADVGIGSTVSIRHIATMGGYLHSHDHMYEKGSQQ
QQVTLYPHLDGNNDWLIELHDKPNTPVTSFEGLKDGTIIKLKHVISQRRLHSHDHKAPVS
ESADWQKEVSCYGFDGFEGDGNDNWAIEIDKDATAPGEAQERVKALETKFRLKHTIMNCH
LFSHEVKLPKWGFEQQEVTCASQGKPHLTLWYIEGNSHPLLNETSERVSYKEPTFLEKLV
ESHQKMWHINKNLNEPHIYESKPHSWPFLLRGINYWGHDHKQVYLLGNAIVWWSVTAFIA
IFGLLVGYELLAWQLGKPILQDAKVVNFHVQTIHYLLGYVLHYIPSFLMGRQLFLHHYLA
AYYFGILALAHAMEITVTYVFRKRETVGYAIAGAFLSAVVYFFVSYRALIYGTPWTNELC
QKSKWLSGWDYPCHNFLSSYEDYKKLETEQAHQPVSPSNTLAAGADSQPTVAQQAPNAQQ
AIPEDFDVDEIIAAPGNKKFVDQNGNELPFDVVKEVLDNGGSVMSVEHRSHTEIL
NT seq 2508 nt NT seq  +upstreamnt  +downstreamnt
atgccaccaaaagcatactcggagtctcaaggaactgggtcccaagatccagttcccgat
ctgaatatcggcaagggaccagagaggccatatgtcgttaccgagccaccttcgagtttg
gtcgagtcacgtacaccaaagtcagcgaaggaaaagttgacaatcgctgttctgcttctc
gtaactgcctttgtgagactttacgggctttcgtaccctaactccgttgttttcgacgag
gttcacttcggtggtttcgcttccaagtacatcaagggtgttttcttcatggatgttcac
ccaccattggccaagatgctcttcgcagctatcggctcaattgcaggtttcactggcgac
tttgactttgaaagtatcggccagatgttccccgcgaccaccccatacttcttcatgaga
cttttcccagccgttctaggtactctcaccgtgcttctgatgtacatgacgctgcgttgc
tccggcgttagagttccaatcgcgttcattgcttctttgtgcttcgcggtggaaaacagt
tacgtcaccatctccagatatatccttctagatgcgcctcttctattcttcatcgcatcc
gccgtttactcctttaagaagtacgagatttacccacaaggttcttggaattctcagaaa
gcgttgctgagcactggccttgcgcttggaatggctttgtccgccaagtgggttggacta
ttcactatcgcctgggtcggaatcttgtgtgtctggagactctggttcatgatcggggat
ttgtctaagcctatcaggaaaaccgttagagaggccgtccgcaagttttctttcctccta
gtcattccccttgtgatttacgtctttttcttctatgtccatttcaagtgcttaactatc
cattccgatggcgccgggtttttctcgtcagcattcagaacaaccttgcaaggaaacacc
atcccacaaaacattttggcagatgtcggcatcggatctactgtatctattcgtcacatc
gccacaatgggtggttacttgcactctcatgaccacatgtacgagaagggttctcagcaa
cagcaagttactctttaccctcacttggacggcaacaatgactggctcattgagttgcat
gacaagcctaatactccagtgacctccttcgaaggccttaaggacggaactatcattaaa
ttgaagcacgtcatctctcaacgcagactacattcccatgaccacaaggcccctgtttcc
gagagtgctgactggcaaaaggaggtttcctgctacggcttcgacggtttcgagggtgac
ggaaacgacaactgggccattgagattgacaaggacgccaccgccccgggcgaggcacaa
gaacgtgtcaaggcgctagagactaaattcagactaaagcacaccattatgaactgccat
ttgttctcgcatgaagtcaagctgcctaagtggggctttgagcaacaagaagttacttgc
gcaagccagggtaaacctcatttgacgctgtggtatatcgaaggtaactcgcaccctctg
ttgaacgaaacctccgagcgtgtgtcttacaaggagccaactttcttggaaaagctagtt
gagtcacatcaaaagatgtggcatattaacaaaaatttgaatgaacctcacatctacgag
tccaagccacattcttggccattcctcctaagaggcatcaattactggggccatgaccac
aagcaggtctacctgcttggtaatgctattgtctggtggtctgttacagcgttcattgct
atttttggtttgcttgtcggttacgagctcctggcctggcaattgggcaaaccaatcttg
caagatgccaaggtggttaacttccatgtccaaaccattcactatctgttgggttacgtg
ctgcattacatcccatcgttcttaatgggacgccaactgtttttgcaccactacttggcc
gcttactactttgggattttggcccttgctcacgctatggaaataacggtaacatatgtt
ttccgtaaaagagaaacggtcggttacgccattgccggggccttcctgagcgccgttgtt
tacttctttgtgtcataccgggccttgatttacggaactccgtggaccaacgagctttgc
cagaagtcaaagtggctttctggatgggactacccttgccacaactttttgtcgtcatat
gaagattacaaaaagctagaaacagaacaagcgcaccagcctgtatctccatctaacacc
ctagccgctggcgccgactctcagcctacagtcgcacaacaagctccaaacgcgcagcaa
gccattcccgaggactttgatgttgacgaaataatcgctgcccctggcaacaaaaagttt
gttgatcaaaacgggaatgagcttccttttgatgtcgtaaaggaagttctggacaacggg
ggatctgtcatgagcgttgaacaccgctctcacactgaaatcctttaa

DBGET integrated database retrieval system