KEGG   Lachancea thermotolerans: KLTH0F12826gHelp
Entry
KLTH0F12826g      CDS       T01117                                 

Definition
KLTH0F12826p
Orthology
K13996  
protein disulfide-isomerase [EC:5.3.4.1]
Organism
lth  Lachancea thermotolerans
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:lth00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    KLTH0F12826g
Enzymes [BR:lth01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     KLTH0F12826g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
F:1064524..1066704
Genome map
AA seq 726 aa AA seqDB search
MKLLRIGFLQVRITALHKNETLIKGAVKMRLKQLLLSLVLCTRLVVPLDDAESVDEDPFP
QPVSAAGFREAISKHLQLVEFYSPFCHHCKKLAPVWEKTWKSFREEGEKLNISLIQVNCV
ENGDLCAEERIQAFPSIKLYGPSGFIKDFPNSWKRNEKTISNFARQEAMNLDNFDTSLLY
SKSKSLDGPEFLELIAGNGNLPNLVSFWPSEDLKNVDDNSFEFENCDECHGFQKIWTLLS
NKLEPEGFVTSHFNCAANKKICQELGLENLAKLTNHRSDRKPQVALVLPNKTVNNLFFYH
KYDDSVQSYADFATRTYSNAQIPETNMKSLGQLIEEPLELKKGQKSSDANIYVVFKYESE
TVVQEDFEILEQLIEPISRIPNAFLYKSSDDMMGLSRRLFNQMYNVINYEDNEEQKKPNE
EFFVMSTLTQYPTFFLFKQGNLVPTVFHGYSTTEMRNLNFILKWLSENSLPLLNEVTSEN
FDSLLGYHSELYNTMAVQLLDTSSESEYSRSMTYVENFLTSAFDYEATRSDFLYETVLNK
RLMKEEAVRSLKNKNAPSTEIVKKMRDEIVHNDDHRALFAYLDLASHKALLTQAGLNAYD
RTYKNGDVLIIDKVTGSYYYDRDQVGNMLTTTSPSQLKNTLARLNFPTKFSRSALAKIPI
QNLNRGLTSILRPVLHPGLAGYALACVAFLFAFLRISKAYRKSVIGRKYRSKRDVTGILG
KPKPIE
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atgaaattattacgaattggtttccttcaggtgcggatcacagcccttcacaaaaacgaa
actttgatcaagggtgctgtgaaaatgcgcttgaaacaacttctgctgtcattggtgctt
tgcacccgccttgttgtgccgcttgatgatgccgaaagtgtggacgaggacccatttccc
cagccagtatctgccgctggttttcgagaggcaatctcgaaacatctccagctagtcgag
ttctacagtccgttctgtcaccactgtaaaaaacttgcgccggtctgggagaaaacgtgg
aaatcgtttcgtgaggaaggggaaaaactcaatatatctttgatacaggtaaattgtgtg
gagaacggtgacctttgtgcagaggaaagaattcaggccttccccagtatcaagctttat
gggcccagtggcttcatcaaagatttccctaattcatggaaacgtaatgagaagacaatc
tcaaattttgctcgtcaggaagcgatgaatttggataactttgatacctcactcctgtat
agcaaaagcaaatccttagatggccctgagtttttagaattgatagcgggcaatggcaat
ctgcctaacctggtgtcgttttggccgtcggaagacctcaaaaacgtagatgataattct
tttgagtttgaaaactgcgacgagtgtcatggttttcagaagatttggacgctgttgtcc
aacaaacttgaacctgagggtttcgtcacctcccacttcaactgtgctgcgaacaaaaag
atatgtcaggagcttggccttgaaaatctcgcaaagctgaccaaccataggtcagacaga
aagcctcaggttgcgttggtccttcccaacaaaactgtcaacaatttgttcttctatcac
aaatatgacgatagtgtacaaagctacgccgatttcgcgacgcgaacatactctaatgct
cagatcccggaaaccaacatgaagagccttggccagttgattgaagaaccgctagagctg
aaaaagggtcaaaaaagctcggacgcaaacatttacgttgttttcaaatatgagtctgaa
actgtggttcaggaagatttcgaaattttggagcagcttattgagcctatctccagaatt
cccaatgcctttctttacaaaagttcagatgacatgatgggattatcgcgccggctcttc
aaccaaatgtacaatgtgattaactatgaggataatgaagaacagaagaaaccgaacgag
gagttttttgtcatgagcacacttactcaatatccaacgttttttttgtttaaacaaggc
aacctggttcctaccgtttttcatggatactcaacaactgaaatgcggaatctcaacttc
attttgaagtggctgagtgagaattctctacccttactcaatgaagtcacttcagaaaac
ttcgactcattgcttgggtatcattctgaactctataatacgatggctgttcagctgctt
gatacttcatccgaatccgagtattcaagaagtatgacctacgttgagaactttttgaca
agtgcattcgactatgaagccaccagaagtgacttcttgtatgaaaccgttctaaataaa
agactgatgaaagaagaagcagtgaggtccttgaagaacaagaatgcaccttcaacagaa
attgtgaaaaagatgcgggacgagattgttcacaatgacgatcaccgggcgttattcgcg
taccttgatcttgcgagtcataaggcacttttgactcaggctggcctgaacgcctatgac
cgcacatataagaatggtgatgtcttgattattgacaaagtgacaggctcctactattat
gatcgggaccaagttggtaatatgctaacgacaacatctcctagccaactgaaaaatacg
ttggcaaggctgaattttccaacaaagttttcgcgctccgccctcgctaagatccccatc
caaaatttgaatagaggcttgacttctattctgagaccagttttacatcctggattggcg
ggatacgcactagcttgcgttgccttcctatttgctttcctaaggataagcaaggcctac
aggaagtctgtgattgggcgtaaatatcgcagtaaacgcgatgttacaggtatacttggg
aaacctaagccaattgaatga

DBGET integrated database retrieval system