KEGG   Lachancea thermotolerans: KLTH0F13794gHelp
Entry
KLTH0F13794g      CDS       T01117                                 

Definition
KLTH0F13794p
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
lth  Lachancea thermotolerans
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lth00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    KLTH0F13794g
Enzymes [BR:lth01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     KLTH0F13794g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
F:1133687..1135282
Genome map
AA seq 531 aa AA seqDB search
MIPQCGKLAANANVAVVGAGVGGLSFAYFLSKLRPDVNVTVVEASKRQGGWINSSKIEDK
PGHAVVIEKGPRTLRGVAPGTTLIIDTLKALNQESAVFYIESQSEANRKFLLAPNDQLVQ
VPNSLRTFYKFISGPLGKGFGSGLLGEAFRKGPVNKISDESAHNFISRRFGNEYVSNNIF
SALFHGIYAGDIKKISAKKTLGTMVELEQKQGSLIRGMIKKYMSKSDGVSEPQLPDSLKE
YGNLMGRDMPDLMKLHSTLKKLPMLGLQNGLETFPESLAIALGQMSNVKILSGDASSRLS
MSDGSKAEIHLESGRKLANFDHIRLTNTPGVISKMIQNKDLIRQLQKVHSNTVVLVNFYL
AGEDLVDTYHSFGYLVPQSNRNEERLLGVIFDSVIEQNFKPFVKSGVPHAAVRQKGKYTK
LTAMLEGHYLNEEGLAGLKEDSFYVGSVKRALSRHMGIPEEALNRGIWQVTPAKECLPQF
FVGYDDWLAQLSKRFVENYGSHVSLGGMAFGKGPGVPDVVMDGFEDAAKLA
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgatcccacagtgcggtaagcttgcagctaacgccaacgttgcagtggtaggtgctggt
gttggcggcttgagtttcgcctacttcttaagtaagctaaggccagatgttaacgttact
gttgttgaagcatcaaaaagacaaggtggatggatcaattccagcaagatcgaagataag
ccaggacatgcggttgtcatagagaaagggccaagaactcttcgaggggttgccccaggg
acaaccttgattattgacacactcaaggctctaaaccaggaaagtgctgtgttttacatc
gaaagtcaatcagaagctaaccgcaagttcttgttggctcctaatgaccaactggttcaa
gtcccgaactcactgcgcactttttacaagtttatctcgggtcccttagggaaaggcttc
ggaagcggtcttttaggcgaagcttttagaaaagggcctgttaacaaaatttcagacgaa
tcagcacacaatttcatatcccgtagatttggtaatgaatatgtcagtaacaacattttc
agcgcgcttttccatggtatatacgcgggggacatcaaaaaaatcagtgccaagaagact
ctgggaacgatggttgagctagagcagaagcaaggctccttaattagaggaatgataaag
aaatacatgagcaagtcagatggtgtttcagagcctcagttaccggactccttaaaggag
tatggaaaccttatgggcagagatatgcccgaccttatgaagctgcattccacgctgaaa
aaactaccaatgttgggtctgcaaaatggcttagagacctttcctgaatccctggcaatt
gctttgggtcagatgtctaatgttaagattctctcaggggatgctagctctcgtttaagt
atgtctgatggcagcaaggccgaaattcacttagagagcggcagaaaactggcgaacttt
gatcatataagactcacaaacactcctggcgtcatttctaagatgatacaaaacaaggat
ctcattcgccagctgcaaaaagtccactcgaacacggttgttttggtaaacttctaccta
gccggtgaggacttagtcgatacataccactcatttggatacctcgttccacaatcaaac
cgcaacgaggagagactccttggcgtcatatttgattcagtaattgagcagaactttaag
ccgtttgttaaatctggtgtgccacacgcagcagtcaggcagaagggtaaatacacgaag
ttgactgcaatgttagaggggcattatttaaatgaggaaggattggcgggactaaaagag
gattccttctacgtaggctctgtcaagcgcgccctttctaggcatatgggaattcctgag
gaagcgctaaaccgtggaatctggcaagtgacaccagccaaagaatgtcttccccaattt
tttgtgggatacgatgattggcttgcgcagctaagtaagcgttttgttgagaactatggc
tctcatgtttctttgggtggtatggctttcggaaaaggaccaggtgttccagatgtggta
atggatgggtttgaagacgctgcaaagctggcttga

DBGET integrated database retrieval system