KEGG   Lachancea thermotolerans: KLTH0F14630gHelp
Entry
KLTH0F14630g      CDS       T01117                                 

Definition
KLTH0F14630p
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
lth  Lachancea thermotolerans
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:lth00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
F:1198036..1199757
Genome map
AA seq 573 aa AA seqDB search
MCGIFTCFRHQSVEEFKPDALRLVKRIRHRGPDWSGNIIKNSTLMAHERLAIVGLDSGAQ
PFVSEDNNYILGVNGEVYNHIQLREEFSSYPFKTLSDCEPIIPLYEKYGIDAPKYLDGMF
AWALYDAKKDRIVAARDPIGITTLYMGRDSKSPKTVYFASELKCLTDNCDSIIAFPPGHV
YDSETDQITRYFNPDWIDEDRIPSEPLDLLKIRHSLEKAVRKRLMAEVPYGVLLSGGLDS
SLIASIAARETEKANSQMDPVKYDSEDKHLAGVDDAGNLRSAGWSHLHSFAIGLPNAPDL
QAARKVAKFIGSIHHEHTFTLQEGLDALSDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEAR
VPFLDREFLQLCMNLDPKEKMINAAEGRIEKYILRKAFDTSDEPGAKPYLPEEILWRQKE
QFSDGVGYSWIDGLKDAAEAAISDEQFKQPKAEWGDDIPTTKEAYWYRLKFDALFPQKTA
ASTVMRWIPKADWGCAEDPSGRYAKIHEQHIDK
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggtattttcacttgcttcagacaccagtctgttgaggagttcaagcccgatgct
ctaagactggtcaagagaatcagacatcgtggcccagattggtccggtaacatcatcaaa
aacagcacactaatggctcacgagagattagctatcgtcggcctggactctggtgctcag
ccttttgtgtctgaggacaacaactacatcttgggtgtcaacggtgaagtctacaaccac
atccagttgagagaagaattctcttcttacccattcaagacactctcggactgtgagcct
atcattcctctgtacgagaagtacggcatcgacgcccccaagtacctcgacggtatgttc
gcgtgggctctgtatgacgccaagaaggaccgcatcgtcgctgccagagaccctatcggt
atcactaccctgtacatgggcagagactccaagtcgcctaagactgtgtactttgcctcg
gagctcaagtgcttgaccgacaactgtgacagcatcatcgctttccctccaggtcacgtt
tacgactctgagacggaccagatcacccgttacttcaacccagactggatcgacgaggac
cgtattccatctgagcctctagatctcctcaagatccgccactcgttggagaaggcggtc
agaaagagactgatggccgaggttccttacggtgtgctgttgtccggtggtctggactct
tcgctgattgcgtctatcgccgccagagagaccgagaaggccaactcccaaatggaccct
gtcaagtacgactccgaggacaagcatctggcaggtgtggacgatgccggaaacctgcgc
agtgccggctggtcgcacttgcactctttcgccatcggtctaccaaacgccccagacctg
caagccgcgcgcaaggtcgcgaagttcattggctccattcaccacgagcacactttcacg
ctgcaagagggtctggatgcgttgagcgacgtcatctaccacttggagacctacgacgtg
accaccatcagagcatctacccctatgttcctgctatctagaaagatcaaggcccagggt
gtcaagatggtgctgtccggtgaaggttcagacgagatcttcggcggctacctgtacttc
gctcaagctccttccgccgcggagttccacaccgagtctgtcaagcgtgtcaagaacctg
catttggctgactgtctgagagccaacaagtcgaccatggcttggggtttggaagcgcgt
gtgcctttcttggaccgcgagttcctgcagctgtgcatgaacttggatccaaaggagaag
atgatcaacgccgcggagggccgcatcgagaagtacattctgaggaaggccttcgacaca
tcggacgagcccggcgcgaagccatacctgccagaggagatcttgtggagacaaaaggag
cagttctccgacggtgtgggctactcgtggatcgatggcctaaaggacgccgccgaggcc
gccatctccgacgagcagttcaagcagccaaaggccgagtggggcgacgacatcccaacc
accaaggaggcctactggtacagactcaagttcgacgcgctcttccctcagaagaccgcc
gcctccacggtgatgaggtggattccaaaggccgactggggctgcgccgaggatccttcc
ggcagatacgccaagatccacgagcagcacatcgacaaataa

DBGET integrated database retrieval system