KEGG   Lachancea thermotolerans: KLTH0F15862gHelp
Entry
KLTH0F15862g      CDS       T01117                                 

Definition
KLTH0F15862p
Orthology
K11849  
ubiquitin carboxyl-terminal hydrolase 25/28 [EC:3.1.2.15]
Organism
lth  Lachancea thermotolerans
Brite
Enzymes [BR:lth01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     KLTH0F15862g
Peptidases [BR:lth01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   KLTH0F15862g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
F:1288742..1292467
Genome map
AA seq 1241 aa AA seqDB search
MFKDFSGSEAPVYEPADSISKPIDDGGLEDGGSTQDNGKALLYPDAGSLFPFKTSERLLD
EIKAELAYRNSNGHDILYSALHSGVLKLPVLEYSRKPVPDPFSIGHLLDQVVLKTRYEYE
SRTCPGLNKVSVFMGVLVSPSIVPREPEDLAAAPIYHLKLTVKTRMHLEHTRKQAGVCQY
HMLSELHPSDKQDLFLAEESDPSLLDSAMYVSSDTNKLVCIEIFKPEFSHEDLATFSPDS
IRRRFAEACGKFPDLDPEKVPSQAECFSTLLKIFKGPLNRRSPDDVLKTISADNKFLNSQ
IEPAWLTERFQFQLCETQASEEPETALEYQPPDLTDYVNNLSVRKLREEYTRKCLELVFL
GKMAVALMSKDDVAQDSRARSFHLYQISYSPSFFFHLLGETRGVMDYGTQEIDKNYHFIN
LSACHYYSDKDIIKNYETQARLDPENIGIYFDALNFIANFKGSYQLITYCRKQDVVGKEA
LDSALSLFGIDASDTDLSTVPDDLLLGIYRKESSQASQQKRSSLKNSLRLIAKAKKSQIL
QFYTAYEPYDNTYQAYSLLEVNESVDVDIIQTAYTVKVTDSPGLKIDCDRAIYTIAVSRR
SMPLFNFLAEQCPAFNEFYSADKLTYQEALNLLQVNENASDDVILEVFQRKWHQEPVSSP
DQFLISSSALTKIGQVRNSLLINRYLETGIIDVSCLPAGNWPTGLNNIGNTCYLNSLLQY
YFCISPLRQSIVEYQKTLSEFHQSIGHLESKRRIGGREVSEAEVERSIQFVYQLRDLFTD
MVHTENRYVTPTKELAYLAFAPSNIEVEFEGTPSSGSVGEAEDEEEGAIKETTEVIDLTS
VPNAEQDIEMLDPVPSESEMIVEQFVDSPKDDKKQDAAEAIGTSTRVAKISSDQLENALE
MGRQQDVTECIGNVLFQLESASEPTCLDTDGEQQDLIKQLFFGKLRQVLTPLNDPTKVRT
KIERFVSLLVNVGDHPKDVYDALDQYFKNDVLQLEDGDVNRSVAIKELPAVLQIQIQRVY
YDRERFMPFKSIEPLPFEDSIYMDRYMDTEDPVMLKKREEAATLKKELVTLKEKQRSLLD
KNGSGMSFKSSLLETKRFLQSDVLENNDIESPNKEQSIQTIDSMLLKIDEELASVYHRIA
FLEQKLSSHFDDFKQEGYSLFAVFIHRGEASYGHYWIYIKDSGKNGIWRKYNDESVTEAP
ESEVFNFSEGNTATPYFLVYVKNGQESQIEPLHRVTTKCAS
NT seq 3726 nt NT seq  +upstreamnt  +downstreamnt
atgttcaaggacttctcaggctccgaggcgccggtttacgagcccgcagactcaatatcc
aagccaattgatgatggcggcctagaggacggcggttcgacgcaggataacggcaaggcc
cttctgtaccctgacgcaggcagcctctttcctttcaagacctctgaaaggttgctggac
gagatcaaggccgaacttgcgtacagaaactccaacgggcatgatatactgtactcggcg
ctacatagtggcgttctgaagctccccgtcctggagtattcgcgaaagccagttcctgac
ccgttcagcatcgggcacttgctggaccaggtcgtcctcaaaacgcgctacgaatatgag
tcgcgtacatgccccggcctcaacaaggtcagcgtcttcatgggcgtgctagtcagcccc
tccatcgtgcctcgggaacccgaagacctggcggccgcccccatctatcatttgaagctt
actgtcaagaccaggatgcatttggaacacacgcgaaagcaggctggggtctgccaatac
cacatgctctctgagcttcatccttccgacaaacaagacctatttcttgctgaggagtcg
gaccctagtcttttagactccgccatgtatgtctccagtgacactaacaagctggtctgc
atagaaatatttaagcccgagttctcacacgaagatctcgcgactttcagccctgatagt
atccggcgcaggttcgctgaggcttgcggaaagtttccagacctcgatccagaaaaggtg
ccgtcgcaagccgagtgtttcagcactttgctcaaaatattcaaagggccgttgaacagg
cgtagtccggacgacgtgctgaaaaccatatctgcagataacaagtttctgaactcgcaa
atagaacccgcttggttaacggagaggttccaattccagctgtgtgaaacgcaagcctca
gaagaacctgaaactgccctcgagtaccagcccccagacctgacagactatgtcaacaac
ctgtccgtcaggaagcttagagaagagtacacccggaagtgcttggagttggtgtttttg
ggcaaaatggccgtcgccttgatgtcgaaagatgacgtagcccaggattcccgggccaga
tcgtttcatctataccagataagttactctccatcatttttcttccacttattgggcgaa
acccgcggtgttatggactatggtacccaagaaatcgataaaaactaccacttcatcaac
ctgtcggcttgccactactactctgataaagacataattaaaaactacgagacgcaagct
cgtttggaccctgaaaacattggaatttattttgacgcattgaacttcattgcaaacttc
aagggtagctatcaactcataacttactgccggaagcaagacgttgttggtaaggaagcc
ttagattctgcactgtctctatttgggattgatgcatctgatacagatctgtcgacagtg
cctgatgatctcttattaggaatctacagaaaagaaagcagtcaggcgtctcaacagaag
cgctcgagtctcaaaaactctctaaggttaattgcgaaggccaaaaagagccaaatattg
caattttacaccgcttacgaaccttatgataatacttaccaggcatattccttgttggaa
gtcaacgaatccgtagatgtcgacattatccaaacagcatacacggtaaaagttactgac
tcacccggactaaagatcgactgtgacagggcaatctacactatagcagtatcgaggagg
agcatgcctttgttcaattttttggcggaacagtgtccggcatttaatgagttttactca
gcagacaagcttacctaccaagaagctctaaacctacttcaagtcaatgaaaatgcctct
gacgatgtgattttagaagtgtttcaaagaaagtggcaccaagaaccagtttcatctcct
gaccagtttctgatttcttcaagtgccttaaccaaaattggccaagttcgcaattctctc
cttatcaatcgttatttggagactggtatcattgacgtttcctgtcttcctgccggaaac
tggccaacaggcttgaacaacattgggaatacatgttatttgaactcgcttttacagtac
tatttttgtatttctccccttcgccagtcaatcgttgagtaccaaaagactctcagcgaa
ttccatcaatctattggtcatttggaaagcaaaaggcgtattggaggaagagaagttagc
gaagccgaagttgagagatcaattcagttcgtttaccagttaagagacctttttacagat
atggttcacactgagaacagatacgtgacacctacaaaagaactggcatatctcgctttc
gctccaagtaacatcgaagttgaatttgaaggaacaccatcttccggtagcgtaggggag
gcagaggatgaggaggagggggccattaaagaaactacggaagttattgatctgacatct
gtcccaaatgcagagcaggacattgaaatgctggaccctgttccttctgaatctgaaatg
atagtcgagcaattcgtcgattcaccaaaagatgacaagaaacaagatgctgctgaggct
ataggaacatctaccagagtagccaaaataagttcagatcaactagagaatgcgcttgaa
atgggtaggcagcaagatgtaacagagtgcattggtaacgtgctttttcagcttgaaagt
gcatctgaaccaacctgcttggatactgatggggagcagcaagatctcattaagcaactc
ttttttgggaaactgaggcaagttttgaccccgctaaatgacccaacaaaagtcagaaca
aaaattgagcggtttgtatccctgctggtcaacgttggagatcatccaaaagacgtttac
gatgccttggatcaatatttcaagaatgacgttttgcaactggaagacggggacgtaaac
agaagtgtggcaataaaagaattaccagctgttcttcaaattcaaattcagcgtgtttat
tacgaccgcgagcggttcatgccattcaaatcaatcgagcccttaccttttgaggattcg
atttatatggatagatatatggacaccgaagatcctgtgatgttgaagaaacgggaagaa
gctgcaacactgaaaaaagaacttgtaacgctgaaagagaagcagaggtctctccttgac
aagaacggaagtggaatgagcttcaagagttctctgctcgaaacaaagcgctttttacaa
tccgacgtactggagaataacgatatcgaatctccaaacaaggagcagtccatccaaaca
atcgactcaatgctcttgaaaatagacgaggagcttgctagcgtttatcatcgaattgca
tttctcgagcagaaactgagctcccacttcgatgacttcaaacaggaaggatattcactt
ttcgccgtctttattcatagaggtgaggccagctacggccactattggatatacatcaaa
gacagtggcaagaacggaatttggagaaagtataacgacgaaagcgtaactgaggcgcct
gaaagtgaagttttcaatttttcagaaggtaatacagccacgccatatttcctcgtgtac
gtcaaaaatggacaagagtcacaaatcgagccacttcatagagtaactaccaagtgtgcc
agctaa

DBGET integrated database retrieval system