KEGG   Lachancea thermotolerans: KLTH0F15950gHelp
Entry
KLTH0F15950g      CDS       T01117                                 

Definition
KLTH0F15950p
Orthology
K05759  
profilin
Organism
lth  Lachancea thermotolerans
Brite
Exosome [BR:lth04147]
 Exosomal proteins
  Proteins found in most exosomes
   KLTH0F15950g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
F:join(1297129..1297141,1297227..1297594)
Genome map
AA seq 126 aa AA seqDB search
MSWQAYTDNLLGTGKIDKAAIYSRAGDSLWAASGGLSLPTNEIGEIAQGFENPSGLQSTG
LHLQGQKFMLIRADDRSIYGRHDAEGVICVRTKQTILVTHYPAGVQAGEATKIVEQLADY
LISVSY
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgtcttggcaagcgtacaccgacaacctcctaggaactggcaaaattgacaaagcagcc
atctattcgagagctggcgactccctgtgggctgcgtccggtggcctgtcacttcctacc
aacgaaatcggcgaaattgcccagggctttgagaacccgtccgggttgcagagcacaggc
ctgcatctgcaaggtcagaagttcatgctgatcagagctgacgacagaagcatctacggc
agacacgacgctgagggtgttatctgcgtgcgcacgaagcaaactatcttggtgacacac
tacccagccggcgtccaggccggagaggccaccaagattgtcgagcagctagccgactat
ctgatcagtgtctcatactaa

DBGET integrated database retrieval system