KEGG   Lachancea thermotolerans: KLTH0F19118gHelp
Entry
KLTH0F19118g      CDS       T01117                                 

Definition
KLTH0F19118p
Orthology
K10739  
replication factor A2
Organism
lth  Lachancea thermotolerans
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Brite
KEGG Orthology (KO) [BR:lth00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    KLTH0F19118g
   03420 Nucleotide excision repair
    KLTH0F19118g
   03430 Mismatch repair
    KLTH0F19118g
   03440 Homologous recombination
    KLTH0F19118g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
F:complement(join(1548991..1549820,1549887..1549893))
Genome map
AA seq 278 aa AA seqDB search
MATYQPYNEFSTVSGGGFDNSQSSGRPNSGNGGSGSSSTLTPVTIKQVQESKQIVQDGPF
VVNNLELHHVSFVGVVRNVVDNTSNINLTIEDGTGQIEVRKWSDDSNDMANAAQDEQPDA
AESSQVAQMYEVGTYVRVFGALREFSGKKNVQFAVIKPIDNFNEVITHYLEAMKWHAIAN
GKLESPVNLQPNSEQTGEEQNLFVQDNSASEPKTALHKILEFCTAQCEGKDASSFAVHTK
LIAQSLALSEPDVKMYCQTLVDQGFIYPTFDDSSFFVL
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atggcaacatatcaaccctacaacgagttctcgacggtatcgggtggcggattcgataat
tcgcaaagctctggtcggcctaactccggaaacggaggatcgggatcttcttcgaccctt
accccggtaaccattaagcaagtacaggaatcaaagcaaatagtgcaagacggccctttt
gtcgtgaacaatttggagcttcatcacgtatctttcgtgggggtggtacggaatgtagtg
gataacacatcgaatatcaacttaactatagaagatggaactgggcagatcgaagtgcgg
aagtggagtgacgactcaaatgacatggccaatgcggcacaggatgaacaacccgatgca
gctgagagctcgcaggtcgcgcaaatgtatgaggttggaacttacgttagagtgtttggt
gcgctgagggagttcagtggcaagaaaaatgttcagtttgctgtaattaagcctatcgat
aatttcaacgaggtgataacgcattacttagaggctatgaagtggcatgcaattgcgaac
gggaaacttgagagccctgtaaatctgcagcccaactctgagcaaaccggcgaagagcag
aacctatttgttcaggataactcagctagcgagccgaaaacagcattgcacaagatcctg
gaattctgtaccgcccagtgtgaaggcaaagatgctagcagttttgctgtccacactaag
ctgattgcgcagagccttgcgctgtcagaaccggacgtcaaaatgtattgtcaaactttg
gttgatcaaggtttcatttatcccacctttgacgatagtagtttctttgttttatag

DBGET integrated database retrieval system