KEGG   Lachancea thermotolerans: KLTH0F19382gHelp
Entry
KLTH0F19382g      CDS       T01117                                 

Definition
(RefSeq) KLTH0F19382p
  KO
K03259  translation initiation factor 4E
Organism
lth  Lachancea thermotolerans
Pathway
lth03013  RNA transport
Module
lth_M00428  eIF4F complex
Brite
KEGG Orthology (KO) [BR:lth00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    KLTH0F19382g
Messenger RNA biogenesis [BR:lth03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     KLTH0F19382g
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     KLTH0F19382g
Translation factors [BR:lth03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    KLTH0F19382g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IF4E
Motif
Other DBs
NCBI-GeneID: 8293265
NCBI-ProteinID: XP_002555029
UniProt: C5DJV3
Position
F:1570473..1571102
Genome map
AA seq 209 aa AA seqDB search
MSVEEVTQKTGDLNIDEKSTVLSSEKEFQLKHPLNTKWTLWYTKPPVDKSESWSDLLRPV
TSFETVEEFWAIHNAIPKPRYLPLKSDYHLFRNDIRPEWEDPTNAQGGKWTHQFWGKTPD
IDDLWMRALLAVIGETIDEDDSEINGVVINIRKSAYKIAIWTKSADNKEALTRIGSKFKT
VLKLGDDAQLEFLPHSTASEKHPQPSLVL
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtggaagaagttactcagaaaaccggggatttgaacattgacgagaagtcaact
gtgttgtccagtgagaaagagttccaattgaagcatccattgaacaccaaatggaccttg
tggtacactaagcccccagtagacaagtcagaatcgtggtcagacctgctgcgtccagtg
acatctttcgagacagttgaagagttctgggctatccacaacgctattcccaagcctcgt
tacttgccactcaagtcagactaccacttgttccgtaacgacatcaggccagagtgggag
gacccaaccaatgcacaaggcgggaaatggactcatcaattctggggcaaaactcccgac
atcgatgacttgtggatgcgcgctctgcttgcggtcatcggcgagactattgacgaagat
gactccgagatcaacggtgttgttatcaacatcagaaagagcgcctacaagatcgccatc
tggaccaagtctgctgacaacaaggaagcactcaccagaattggctccaagttcaagact
gttctgaagctgggcgacgatgctcaactggagtttttgcctcactccactgcttctgaa
aaacaccctcagccttctctagttttgtaa

DBGET integrated database retrieval system