KEGG   Lachancea thermotolerans: KLTH0G01892gHelp
Entry
KLTH0G01892g      CDS       T01117                                 

Definition
KLTH0G01892p
Orthology
K04646  
clathrin heavy chain
Organism
lth  Lachancea thermotolerans
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:lth00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    KLTH0G01892g
Exosome [BR:lth04147]
 Exosomal proteins
  Proteins found in most exosomes
   KLTH0G01892g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
G:complement(142143..147116)
Genome map
AA seq 1657 aa AA seqDB search
MSDLPIEFTELVDLTSIGISPQSLDFRSTTFESDRFVTARESQNGANSVAIVDLQNGNQV
TRKNMGGDSAIMHPSQMVISVRANGTIVQIFNLETKTKLKSFTLEEPVLFWKWLSEETLG
FVTANSLYVSNVFDGDTSRKPSKLTQRHANLNNAQIINFVANKRLDWFAVVGIIQENGRV
AGKIQLFSKARGISQAIEGHVATFSTILLEGNTQPVQVFVTGNKTASGTGELRIIEIDHD
ASNAVSYQKKTVDIFFPPDAVNDFPISVQVSEKYGVIYVLTKHGFIHLYELETGANLFVN
RITVEPVFTATTYNQKNGIACINRRGQVLAVEISTDQIVPYVLNKLSNVSLALKMASRGG
LPGADDLFNKQFDTLLASGDYQNAAKVAASSQQLRTQTTINRLKNIQAPPGAISPILLYF
STLLDKGKLNKYETIELARPVLQQDRKQLFEKWLKEDKLECSEELGDVVKPFDTTLALAC
YLRAEAHSKVVTCLAELQQFDKILPYAQKVGYQPNFIVLISNLARSSPDKASEFAVSLLQ
SPETASQIDIEKIADIFFAQNFVQQGTSFLLDALKGDTPDQGHLQTRVLEVNLLHAPQVA
DAIMGNSIFSHYDKPTIASLAEKAGLYQRALENYTDIKDIKRCIVHSNALPIDWLVAYFG
KLNVEQSVACLRALLDDNLQANVPIAIQVATKYSDLIGSQVLIKLFEEYRATEGLYYYLA
SLVNLTEDKDVVFKFIQAAAKVGQFKEVERIVKTNNVYDPEKVKNFLKDIKLADQMPLVI
VCDRFNYIHDLILYLYKAQDFKFIEVYVQQVNPSKTPQVVAALLDVDCDEKVIQNLLGSV
LGQVPIGELTAEVEKRNRLKLLLPFLEDTLRQGTQEQAVYNTLAKIYIDSNNSPERFLKD
NDQYDTLDVGRYCEKRDPYLAYIAYEKGANDDDLIRITNENSMYKYQARYLLKRSDANLW
NKVLDEENIHRRQLIDAVVGTGIGELTDPEPVSLTVQAFMSNGLKGELIKLLEKIILEPS
PFNDNPALQGLLMLSAIRYEPSKVSSYIEKLDKFDEDEIAPLCVENGLNEEAFEIYSKNE
KHDKALQVLVEDVMSLDRAESYVDKINSPELWSQLGAAQLVGLRIPEAINSYIKANDPSN
YETVIEVAEQAEKYEELIPYLSMARSSLKEPKIEGALILSYAKLGKLHEIENLLTGSTVA
DLESVGNKLFEEKDYKAAKLCFSAVSNYSRLATTLVYLNDYQAAVDTARKASNVRVWREV
GDACVDNKEFRLAQICGLNLIVHAEELEELVEKYESHGYFEELISLFEAGLGLERAHMGM
FTELAILYTKYDMGKTYEHLKLFWSRINIPKVIRAVESAHLWTELIFLYAHYDEWDNAAL
TMIDKSADDFDHSYFKEIIVKVSNLEIYYKAINFYVKEHPTLLIDLMTVLSSKLDIPRTI
RIFSKSDNLPLIKPFLVNVLPKNNSVVNQAYHDLMIEEEDYKALQVAVDSYDKFDQLDLA
ARLEKHDLIFFKKIAAQLYRRNKKWSKSLAILREEKLWADAIETAAISQSTEVAEELLNY
FVDTNNREGFVALLYTAYHLIRYEVVLELAWMNSLEDLIKPYEISVKKEQYSNVQKLLEQ
SKSGAKSDAAQSEDQPLLLTNGAMAYQATGQAFGNYA
NT seq 4974 nt NT seq  +upstreamnt  +downstreamnt
atgagtgatctacccattgagttcacggagctggtggatttgacttcaatcgggatttcc
cctcagtccctcgacttcaggtctaccaccttcgaaagtgacaggttcgtcaccgcaaga
gaaagccagaatggcgccaactcggtagccattgtcgacctgcagaatggcaaccaggtc
acccgcaagaatatgggcggcgattccgccatcatgcatccatcgcaaatggtcatttcc
gtaagggccaacggcaccattgtccaaatttttaacctcgaaaccaagaccaaactcaag
tctttcacgctcgaggagcctgtgctcttttggaagtggctcagtgaggagactctcggt
ttcgtcaccgcaaactcgctgtacgtttccaacgtctttgacggcgacacctccagaaag
ccttccaagctgacccagaggcacgccaacctgaataatgcccaaatcatcaatttcgtc
gctaacaagcgactcgattggttcgccgtagtcggtatcatacaggagaatggccgcgtc
gcaggcaagatccagctcttctccaaggctcgtggcatttctcaagccatcgagggtcat
gtcgctactttttccaccattcttctcgagggtaacacccagcctgtgcaagtttttgta
acgggcaacaagactgcctccggtaccggtgagctgcgcattatcgaaatcgaccatgac
gcctctaacgctgtatcctaccagaaaaagactgtcgacatcttctttcccccagacgct
gtcaatgactttccaatctccgtccaggtttcggaaaagtacggtgttatctacgtactg
accaagcatggtttcatacatctgtatgagctggagactggtgccaacctgtttgtcaac
aggatcacagttgagccagtcttcaccgcaacaacctacaatcaaaagaacggtattgcg
tgcatcaacagacgcggccaggttctcgcagtggagatttctactgaccaaattgtccct
tacgttctcaacaaattatcaaatgtgtccctcgccctcaaaatggcttccagaggaggc
ttgcccggcgccgatgaccttttcaacaaacagtttgacaccctgctggcttctggagac
taccagaacgcagctaaagttgcagcctcttctcagcagctgcgtactcagaccactatt
aacagattgaagaatattcaagctcctcctggagccatttcgccaattctcttgtacttc
tcaactttattggacaaaggaaagctgaacaagtacgagacaatcgaactggcgagacca
gtgctacagcaggaccgtaaacagctctttgagaaatggctgaaagaggacaaactggaa
tgctctgaagaactgggtgacgtcgtaaagcctttcgacacaactttggccctagcttgt
tacctaagagctgaggcccactctaaggttgtcacttgtctggcagagcttcagcagttc
gacaagattcttccatacgctcagaaagttggttaccaacccaattttatcgtattgatc
tcaaacctcgccagatcctctcccgacaaggcgtcggaattcgcagtgagtttactgcag
tctcctgaaacagcctctcaaattgacattgagaagattgcagacatcttttttgcgcaa
aacttcgtgcagcagggtacctcatttttgttagatgcgctcaagggcgacacccctgac
caaggtcacttgcaaacgcgtgtcttagaggtcaacttgttgcatgctccacaggttgcc
gatgctattatgggaaacagtattttcagccactatgacaaacccaccattgcttcgctc
gccgaaaaagctggtctctaccagagagctctcgagaactatacagacattaaggatatt
aagcgctgtattgtccactctaatgctcttcctattgactggctcgttgcatacttcggt
aagttgaatgttgaacaaagtgttgcatgcttgagagctcttcttgatgataatttgcaa
gcaaatgtcccaatagctattcaggttgcaaccaagtactcagatctgattggctcccaa
gtcctaatcaagttgttcgaggagtacagggcaacagaaggcctttactactacttggcc
tctttggtgaatttgaccgaagacaaagatgttgtgttcaagttcattcaggcagcagcc
aaggttggccaattcaaggaagtggagaggattgttaagaccaacaatgtttacgatcca
gaaaaagtcaagaactttttgaaagacattaaattagcagaccaaatgccactggttatt
gtctgtgaccgtttcaactacattcatgacttgattttgtacctctacaaggctcaagat
ttcaagttcatcgaggtgtacgttcagcaggtcaacccttcaaagacaccacaggttgtt
gctgcgttgcttgatgttgactgcgacgagaaagtcattcaaaaccttcttggtagtgtt
ctgggacaggttcctattggtgaattaaccgcggaagtggaaaagagaaacaggctgaag
cttctgctcccattcttagaagacactttacgccaagggactcaagaacaggccgtttac
aacacgttggccaagatctacatcgattctaacaactctcctgagaggttcttgaaggac
aacgaccaatacgacactttagatgtgggacgctattgtgagaagagagatccttacctt
gcttacatcgcttatgagaaaggcgctaacgatgatgacttgattaggattacgaacgag
aacagcatgtacaaataccaagctaggtatttgctgaagcgctctgacgccaacttatgg
aacaaggtattggatgaggagaacattcacagacgtcaactcattgatgctgttgtcggc
actggaattggcgaattgaccgatcctgaaccagtttctttgacggttcaagcattcatg
agtaacggtctcaaaggcgagctgattaaattgttggaaaaaatcattcttgaaccttct
ccattcaatgacaatcctgctttgcaaggcctactgatgttgtccgccatcagatacgaa
ccctccaaggtcagtagttatatcgagaaactcgacaagtttgatgaagatgaaattgca
ccactctgtgtcgagaacggactcaacgaggaggcttttgaaatttacagtaaaaacgaa
aagcatgataaagctctccaggttttggtggaagatgtgatgtctttggaccgtgctgaa
agttatgttgacaagattaacagccctgaattgtggtcacaactaggtgccgcgcagttg
gtggggctgcgcattcccgaagcaataaactcttacatcaaagctaacgacccttcgaac
tacgaaactgtcatcgaggtggctgaacaagctgaaaagtatgaagagttgatcccttac
ttgtctatggctaggtcttctttgaaggagcctaagatcgaaggtgctcttattttgtct
tatgcaaagctgggcaagcttcatgaaattgaaaacttattgactggttccactgttgcg
gacttggaatctgtgggcaataaactatttgaagaaaaagactacaaagctgcgaagttg
tgtttctctgctgtttctaactactcaagactagcaacaactcttgtttacttgaacgat
taccaagctgccgttgacacagcaagaaaggcctctaacgtcagagtctggagagaggtt
ggcgatgcttgtgttgacaacaaggagttcaggctcgcacaaatttgcggcttgaacctg
attgttcatgctgaagaacttgaggagctagtggagaaatacgagtctcatggatacttt
gaggagttgatttctttattcgaagccggtttgggcctagaaagagctcacatgggcatg
ttcacagagctcgctatcttgtacacgaagtacgacatgggtaaaacctatgagcatcta
aaactgttctggtctagaatcaatatccctaaagtaataagggctgttgaaagtgcccat
ctatggactgaactgattttcctctacgctcactacgatgaatgggacaatgctgcgcta
actatgattgacaaatctgcagacgatttcgatcactcgtatttcaaggaaattattgtc
aaggtgtccaaccttgagatttattacaaagcaatcaatttctatgttaaggagcatcca
acactattaatcgatctaatgaccgttctttcttcaaagcttgatattccaagaacaatc
cgcattttctccaagtctgataacttgcctcttatcaagcctttcttggtcaatgttcta
cccaagaacaattccgtggtcaaccaagcttatcatgacttaatgatcgaggaagaagac
tacaaggctttgcaggttgccgttgattcttatgataaatttgatcagcttgatctggct
gcgcgtcttgaaaagcacgatcttatctttttcaagaagattgctgctcagctttatcgc
aggaataagaagtggtccaagagtttagctatcctcagagaagagaagctatgggcagac
gccattgagacggctgctatttctcagagcactgaggttgctgaggagcttctaaactac
tttgttgatacaaacaacagagaggggtttgttgccctgttgtatactgcttatcacttg
atcagatacgaggtggttctggaactggcatggatgaattctctggaagatctaatcaag
ccttacgaaatttccgttaagaaggaacagtattcaaacgtccaaaagcttctcgaacaa
tccaagtcgggtgccaagtcggacgccgctcaatctgaggatcaacctttattactaact
aatggtgctatggcataccaggctactggccaggcctttgggaactacgcttaa

DBGET integrated database retrieval system