KEGG   Lachancea thermotolerans: KLTH0G02882gHelp
Entry
KLTH0G02882g      CDS       T01117                                 

Definition
KLTH0G02882p
Orthology
K00493  
unspecific monooxygenase [EC:1.14.14.1]
Organism
lth  Lachancea thermotolerans
Pathway
Fatty acid degradation
Tryptophan metabolism
Brite
KEGG Orthology (KO) [BR:lth00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    KLTH0G02882g
  Amino acid metabolism
   00380 Tryptophan metabolism
    KLTH0G02882g
Enzymes [BR:lth01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     KLTH0G02882g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
G:complement(223474..224994)
Genome map
AA seq 506 aa AA seqDB search
MDLVILAFLFCLITFGILKIVLPPWNFPRNIPTIPFYVTFLATIWDVDQEDIYEIYLREP
LEKYGAVKLYFGSRWNIVVSRPELLAQVFKDEDTFAKSGNHKKIPYGVIAAYTGENVISA
HGAIWKTFRRAITPGLQIFDHTPMIKNAEIFCSLISKQLTTSDSDNNEKIHLQSNEQPWE
LQEKKSGIVLMPELIQRLSLANISEVALGFDIETLTKENSELHVKLKNVKSHIFKSLYLN
FPLLDKLPIPSRQRARRFVEDFRECLMEAVETNLLQNYTFEQTAFSSSDLIRSFNKEEIS
KKQLIDNVVIIMVAGHENPQLLLTTCFYMFAKNQKWQKLVREEVQGCAVENLSELPLLNS
FIFECVRMYPPLSQIINRCTSKPCRLGRDIILPRDVYVGYNVLATGRQRSAWGKEAHRFI
PERWGDNIDEIMKEWKHRKNTCAMSAFHGGRRACLGEKLALMEVRIAMSAALKGFEWSLA
PNWADKVTPAGPLCPAGLKVKFTELA
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atggatctcgttattttggcgtttttgttctgccttatcacatttggtattttgaaaatt
gtgctaccaccatggaactttccgagaaatatccccactatcccgttttatgtcacattt
ttggcgacaatatgggatgttgatcaggaggacatctatgaaatttacttacgagagcct
cttgaaaaatacggtgctgtaaagctatactttgggtcacgctggaatattgtggtttct
cgacctgagctactggcacaggttttcaaagacgaagatacctttgctaagagtgggaac
cataagaagattccatacggggtgattgctgcatatacaggcgaaaacgtaatatctgcg
catggggcgatctggaaaacgtttcgccgagcaattacacctgggttgcaaatctttgac
cacacgccaatgatcaaaaatgcagagattttctgctctctcatctcaaaacagctgacg
accagtgattccgataataacgagaaaattcatttacaatccaatgaacaaccatgggaa
ttacaagaaaagaagtctggtattgttttgatgccagaacttattcaaaggcttagtctt
gcgaatatctcggaagtagctctcggatttgatatcgaaactctgacaaaagaaaattcc
gaacttcatgtgaaattaaagaacgtcaaatcccacatattcaagtctctatacctaaat
ttccctttgcttgacaaactgcctatcccctcgcgccagcgagcgagacggtttgtcgaa
gattttagggagtgcttgatggaagcggttgagaccaatctgctccaaaattatactttt
gaacagacagctttttcttcctccgacctcatccgcagtttcaacaaagaggaaatctca
aagaagcagttgattgacaacgttgtaataataatggtggccggccatgagaatccacaa
cttttactgacgacatgcttctacatgttcgccaaaaaccaaaagtggcagaagctagtt
agggaagaagttcaaggttgcgctgttgaaaacctctcagaacttcctcttttgaacagt
tttatctttgagtgtgttcgcatgtacccaccactgtcccaaataataaatcgctgcacc
tcaaagccgtgccgactgggaagagatataatactgccaagggatgtatatgtgggctac
aacgttcttgccactggtcgtcagagatcagcttggggcaaagaagctcatcgattcatt
ccagagagatggggagacaatattgatgaaattatgaaagaatggaaacacaggaagaat
acgtgcgctatgagcgcgtttcatggcgggcgccgtgcttgtttgggtgaaaagctcgca
ttaatggaggtgcggatagcaatgtctgctgcccttaaaggctttgagtggtcgctggcg
cccaactgggccgataaggtgacgcccgcaggccccttatgccccgcaggcttgaaggtg
aaattcactgaacttgcttga

DBGET integrated database retrieval system