KEGG   Lachancea thermotolerans: KLTH0G04422gHelp
Entry
KLTH0G04422g      CDS       T01117                                 

Definition
KLTH0G04422p
Orthology
K11427  
histone-lysine N-methyltransferase, H3 lysine-79 specific [EC:2.1.1.43]
Organism
lth  Lachancea thermotolerans
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:lth00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    KLTH0G04422g
Enzymes [BR:lth01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     KLTH0G04422g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
G:350035..351798
Genome map
AA seq 587 aa AA seqDB search
MSIETSFETGSAKPDEASSLPVASPSKDGGRTTSHVPKKRVNKSLLSLLNDACKYSAYSE
YSMPSGFLRRKGPNSCETTAKGDGLQKETQGSDISSSSISVAVRKQRPASKKRQAELLNN
GSNENLQEAATKKRPSRIKKASHQNKRSFKLVSETAHTPEVSMGLQPDVTSSQNDLMDHG
ILRKELVVSQRANSFIEDPIEHFTCRRDLFDSDALQSKEMFEDELIHSRSLSDPPHVNPN
VVKLRSILYPDYEEEYIVDFSTDLSKYNPMSEIGRIIEYTLQIYVPTKFANQLRKKVVQP
LNKAFDEQNQKGFIQAVEAFNELVKKIPRADIVERLRRTKAVPTSFFHSLLHMVYVRTIH
PKARSLKEYRAFSNNVYGELLPNFLTAAYAQCGLKPGDIFMDLGSGVGNCVLQAALEFGC
SLSFGCELMPSASDLTTTQESELQRRCRLWGLKLCPTQFSLRTSFVNNSTVDELLPKCDV
LLINNFIFDAKLNLQIQKLIQVLKPGCKVISLKNLRPFGYTINFDDVGNIMNRLTVKKYD
LPENSVSWTHRGGEYYISTVGEDIDESIFTTHSKGRVRMGRRVKYTR
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atgagcatagagacttccttcgaaacaggctctgcaaagcctgatgaagcaagttcatta
cctgtggcaagcccatcgaaagatggcggcagaacgacaagtcacgtaccgaaaaagaga
gtaaataaaagccttctctcgcttctcaatgacgcttgtaagtactctgcatacagtgag
tactcaatgcctagcgggtttctgagaagaaaggggccaaacagttgtgagaccactgca
aaaggtgatggattgcagaaggagacacaaggcagcgatattagctccagttccatttca
gttgctgtgcggaaacagagaccagccagtaagaagcgacaagcggagctattgaacaat
ggttcaaacgagaatcttcaggaagcagctaccaagaagaggccctcacgaatcaaaaag
gcgagtcatcaaaacaagcgttcctttaaactcgtctccgagaccgcacatacgccagag
gtttcaatgggcctccaaccggacgttaccagctcacaaaatgatttaatggaccacgga
atcttgcgtaaagaattagtggtttcacagcgagccaactctttcatagaagacccaatt
gagcatttcacttgccggcgcgatttgttcgactccgacgctttgcagagcaaggaaatg
tttgaggacgagctaattcattctcgttcattaagcgatcccccacacgtaaacccaaat
gtggtaaagttacggtcgatattgtatcccgattatgaagaagaatacatcgttgatttc
agtacggatctttcgaagtacaacccaatgagcgagattgggcgaataattgaatacacc
ctgcaaatctatgtccctacaaaatttgccaatcaattgcgtaagaaggtggttcagccg
ctcaacaaggcatttgatgaacaaaatcaaaaaggttttattcaggctgttgaagcgttt
aacgaacttgtaaaaaaaatacctagagcagacattgtcgagcgcttgcgtcgcactaaa
gcagtccccacatcctttttccacagcctactgcacatggtgtatgttagaactattcat
ccgaaggcgagatcactcaaagagtaccgagctttcagtaataatgtgtacggtgaatta
cttccaaactttttgaccgctgcttatgcacaatgtggcctgaagcctggtgatattttc
atggatctcggctcaggtgtgggcaactgcgttttgcaggcagcattagagtttggatgc
agtttaagcttcggttgtgagctcatgcccagtgccagtgatctgacgacgacacaggaa
tcggaactacagagaaggtgcagactctgggggctaaagctgtgtcctacccaattttca
ttgcggacaagtttcgtcaataattcaactgttgatgagctacttccaaaatgcgatgtg
ctgctcatcaacaatttcatatttgacgcgaagctcaatctgcagatccagaaacttatt
caagttctaaaaccaggctgcaaagtcataagcttaaaaaacctcaggccctttggatat
acgataaacttcgacgatgtgggcaacatcatgaaccgtctcactgtcaagaaatacgac
ctcccggaaaacagcgtttcttggacacatcgcggcggtgagtattatatctccacagta
ggagaagacattgacgagtccattttcacgactcactcgaagggccgtgtaaggatgggg
aggagggtcaagtacacacgttga

DBGET integrated database retrieval system