KEGG   Lachancea thermotolerans: KLTH0G04796gHelp
Entry
KLTH0G04796g      CDS       T01117                                 

Definition
(RefSeq) KLTH0G04796p
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
lth  Lachancea thermotolerans
Pathway
lth00230  Purine metabolism
lth01100  Metabolic pathways
Module
lth_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:lth00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    KLTH0G04796g
Enzymes [BR:lth01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     KLTH0G04796g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_16 AAA_22 AAA_18 MMR_HSR1 AAA_33 AAA RNA_helicase AAA_24 AAA_28 RsgA_GTPase ABC_tran T2SSE AAA_14 NACHT NTPase_1 DUF2075 AAA_30 AAA_29 Viral_helicase1 ATPase_2 Rad17 cobW Cytidylate_kin NB-ARC AAA_17 MobB Adeno_IVa2 Pox_A32 KAP_NTPase AAA_19 TsaE AAA_5 AAA_23
Motif
Other DBs
NCBI-GeneID: 8293512
NCBI-ProteinID: XP_002555246
UniProt: C5DLZ8
Position
G:complement(381434..381991)
Genome map
AA seq 185 aa AA seqDB search
MSRPIVISGPSGTGKSTLLKKLFNEFPNKFGFSVSSTTRSPRPGEVNGTHYNFVTVEQFK
EMIADGKFIEWAQFSGNYYGTTIASVNEVTNSGKRCILDIDMQGVKAVKKTDLNARFLFI
APPSVDSLRERLTGRGTETPESLQKRLDAATAEMDYAQTGAHDKIIVNDEVDVAYAQMKE
FIFSE
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgtcctatcgttatttcaggtcctagcggtaccggaaagtccactttgctgaaa
aagctgttcaacgagttcccaaacaagtttgggttttcagtctcgtccaccacaagaagt
cctagaccaggcgaggtcaacggtacacactacaacttcgtcactgtggagcagttcaag
gagatgattgctgacgggaagttcatcgagtgggcccagttttctggcaactactacggg
accaccatcgcgtccgtcaacgaggttaccaacagcggcaagcgctgcattcttgacatt
gatatgcagggtgtcaaggccgtgaagaagactgacctgaatgcgcgctttctgtttata
gcgcctccttcagtcgatagccttagggaacgcctgacgggccgtggcacagagacccca
gagtcgcttcagaaacgtcttgacgccgccacagccgagatggactacgcgcagactggc
gctcatgacaaaattattgtcaacgacgaagttgacgtcgcttacgcgcagatgaaggag
ttcattttctccgagtga

DBGET integrated database retrieval system