KEGG   Lachancea thermotolerans: KLTH0G06006gHelp
Entry
KLTH0G06006g      CDS       T01117                                 

Definition
KLTH0G06006p
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
lth  Lachancea thermotolerans
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:lth00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    KLTH0G06006g
  Amino acid metabolism
   00330 Arginine and proline metabolism
    KLTH0G06006g
Enzymes [BR:lth01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     KLTH0G06006g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
G:474346..475611
Genome map
AA seq 421 aa AA seqDB search
MSTSYTIVIKLGSSSLVDEKTKEPKLSTMAMVVETVVRLRRNGHRVVLVSSGGIAVGLKT
LNLERRPKHLAQVQAIAAVGQGRLIGRWDALFSQFSQRIAQILITRNDIVDWTQYKNAQN
TIHELLQMGVVPIVNENDTLSVSEIKFGDNDTLSAITAALCGADYLFLLTDVDCLYTDNP
RTNPEAKPILVVPATSQVSEGTLGVKTSSGSGSDVGTGGMTTKLIAAELATNAGVNTIIM
KSTEPSNISKVVSYMQSRESATTSANGDIEELQKLELLSLQEGDVPLHTRFVADKKQMHL
KNREFWMLHGLVSKGAIIIDRGAHAALTRKNKAGLLPAGVIEVEGNFHEHECIDLKVGAR
LENGELDPACELETIGRARCNYTSLEISKIKGLQSDQIENVLGYADSEYVAHRENLAFPP
H
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgagcacttcgtatactattgtcattaagcttggatcttcgtccttagtcgatgagaaa
accaaggagcccaagctatccaccatggcaatggttgttgaaaccgtggtgagacttcgc
cgaaacggtcatcgcgttgtgcttgtttcgagcggaggaatcgcggtaggtttgaaaacg
ctcaaccttgaaaggagacccaagcatctcgcacaggtccaggctattgcggcggttggt
caaggaaggctaatcgggcggtgggacgctcttttctcccagttcagccagagaattgca
cagattctgatcacgagaaatgatattgtagactggactcagtataaaaatgcacagaac
acgatccacgagctgctgcagatgggcgtggttcctattgtcaacgaaaacgatacactg
tccgttagtgaaatcaagttcggcgacaacgacacactttctgcgattactgctgcactc
tgtggcgcagactacctgttcctacttacagatgtggactgcctttacacggataatcca
aggacaaatcctgaagcaaaacctatcctggttgtgcccgcgacttcgcaagtgtcggag
ggcacgcttggtgttaaaacttcaagcggatcgggttccgacgtgggtactggcggcatg
accaccaagctaattgctgcagagctagcgaccaatgcgggtgtgaatacaatcatcatg
aaaagtaccgagcccagtaacatctcaaaggtggtttcttatatgcagagtcgcgaatca
gcgacgacttctgcgaacggggacatcgaagaactacagaagctcgagcttttgtcgcta
caggaaggggatgttcctttgcatacaaggttcgtggccgataaaaagcagatgcacttg
aagaacagagagttctggatgttgcatggtcttgtcagcaagggtgccatcattattgac
cgcggcgcgcatgctgccttgacaaggaagaacaaagccggattattgcccgccggcgtt
atcgaagtggagggaaacttccacgagcatgagtgtattgatctgaaagtcggagcgcgg
ctcgagaacggagaactggatccggcatgtgagctggagacaattggacgggcgcgctgc
aattacacaagcctcgagataagcaagatcaaaggtctacagagtgatcagattgagaac
gtattgggctacgcggacagtgagtacgtagcgcaccgggaaaacttggcgtttccacca
cattag

DBGET integrated database retrieval system