KEGG   Lachancea thermotolerans: KLTH0G06600gHelp
Entry
KLTH0G06600g      CDS       T01117                                 

Definition
KLTH0G06600p
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
lth  Lachancea thermotolerans
Brite
Enzymes [BR:lth01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     KLTH0G06600g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
G:525647..527719
Genome map
AA seq 690 aa AA seqDB search
MPLGLDTLDFAVLCALALAVSAYLGRDTLKQLFASNDESIRVNSDSRDIVQTLKDNNKNY
LVLYGSQTGTAEDYAKKFAKELAAKFSLRVMCADVEKYDLHDLNELPEGVVVSFFISTYG
EGDFPDGAVPFEDFLNSLNSDDLNNLRYTLFGLGNSTYEFFNGAGKKTHKLLSEAGATIL
GKYGEADDGAGTTDEDYLGWADSLLEILKTELSLDEHEQKFEPSFHYSVLESGVTDKVSL
GEPTTQYLPDGELTFSPDGRQTGPFDPSYPFVAPIVKSKELFNSDDRNCIHAEFDISGSN
LKYSTGDHLALWPSNSDEKVEQFLSCFGLDSSVVFDLKPLDTTVEVPFPVPTTIGAAVRY
YLEITGPISRQFFSSLVQFAPNDKLKDRLNEISKDKDEFAKSITAKYLNLADALLYLSDG
AKWNSVPWNFLAESVPRLQPRYYSISSSSLSEKQTISVTAIVENMPNPSSEKAEPVTGVA
TNLLRHVQLSQNNENVKSSNLPVHYDLAGPRNLFSSHKLPVHVRRSAFRLPSNPATPVIM
IGPGTGVAPFRGFIRDRVKFAEQQSNVNLGKHLLFYGSRDQNDFLYQEEWPEYSKKLGGS
FELIVAHSRLPGKPKCYVQDKIKERDQEVFDLISKKGAFIYVCGDAKGMAQGVHATLVDI
ISKHSNVDKAEATEMLKLFKTSGKYQEDVW
NT seq 2073 nt NT seq  +upstreamnt  +downstreamnt
atgccacttggattagatacactagatttcgccgtgctgtgcgctctagccttggctgtt
tcagcctacctaggaagggatacgctcaagcagctgttcgcgtccaatgacgagtccatt
cgtgtgaactcggactccagggatatcgtgcaaactctaaaggacaacaataagaattac
ctggttctctatggttcgcagacaggtaccgccgaagactacgctaagaaatttgcaaaa
gagctcgcagcgaagttctctctcagagttatgtgcgctgatgtcgagaaatacgacctt
cacgacctgaacgagcttccggagggcgtggtggtctccttcttcatttccacttatggc
gagggtgacttcccagacggagcagtgccatttgaagacttcctaaacagtctaaacagc
gatgatctaaacaaccttagatacacgcttttcggactaggaaactcgacctacgagttt
ttcaacggcgctggaaagaagacgcacaagttgttgagcgaagccggcgctacaatcttg
ggtaagtatggtgaagcagacgatggtgcaggcaccacggacgaggactacttgggatgg
gcggactcgttgctagaaattttgaagacagagctcagccttgatgagcatgagcaaaag
ttcgagcctagctttcattactctgttttggaaagtggtgtcaccgacaaagtttcattg
ggtgaacctaccactcaatatttgcctgacggagagttgactttcagtcccgacggaagg
cagactgggcctttcgatccatcttatccatttgtggctccaatcgtgaagagtaaagag
ttattcaactcggacgatcgtaactgcatccacgctgagtttgacatctcaggctctaat
ttgaagtattctactggtgaccatcttgctttatggccatccaactctgatgagaaggtt
gagcaatttttgagctgctttggtctggactcgagcgttgtctttgacctaaagccttta
gataccactgttgaagtcccattccctgtcccaacgacaattggagctgctgttaggtac
tacttggagattaccggcccaatttcaagacagttttttagctcgttggtgcaattcgct
ccaaatgataagctgaaggaccgcctcaacgagatttcgaaagacaaagatgagttcgca
aaatcgataacggctaagtatttaaaccttgccgatgctttactatatctttcagatggt
gcaaagtggaactcagttccatggaactttttagcggagtctgttcctcgtctacaacct
cgctactattctatctcttcttcttctttgagtgagaagcaaactatcagtgttactgcc
attgttgaaaacatgccaaacccatcgtctgaaaaagcggagccagtgactggtgttgca
acaaaccttttgagacatgtccaattatcccaaaacaatgaaaatgtcaaatcttccaac
ttgccagttcattacgaccttgcaggtcctcgcaacttgttcagttctcacaagcttcct
gttcatgtgcgccggtcggcgtttagattgccgtcaaaccctgctaccccagtcatcatg
atcggcccaggcacaggtgttgcacctttccgtggttttatcagagaccgtgtgaagttt
gccgagcaacaaagtaacgtcaacttgggtaagcacctgttattttacggctcaagagac
caaaatgatttcttgtaccaggaggagtggcctgagtacagtaaaaaacttggtggaagc
tttgaattaattgttgctcactccagactaccaggaaagccaaaatgctacgttcaagac
aaaataaaagaaagggatcaagaagtctttgaccttatttcgaaaaagggtgccttcata
tatgtttgtggtgatgccaagggaatggctcaaggtgtccacgcaaccttggttgatatc
attagcaagcatagtaatgttgacaaggccgaggccactgaaatgttgaagcttttcaag
acgagcggtaagtatcaagaagatgtttggtaa

DBGET integrated database retrieval system