KEGG   Lachancea thermotolerans: KLTH0G06974gHelp
Entry
KLTH0G06974g      CDS       T01117                                 

Definition
(RefSeq) KLTH0G06974p
Organism
lth  Lachancea thermotolerans
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
G:556626..558125
Genome map
AA seq 499 aa AA seqDB search
MVESLERHTFKVFNQDFTVDKRFQLIKEIGHGAYGIVCSARFVEAAEETNVAIKKVTNVF
AKTLLCKRSLRELKLLRHFRGHKNITCLYDMDIVFSPDNSFNGLYLYEELMECDIHQIIK
SGQPLTDAHYQSFIYQILCALKYIHSADVLHRDLKPGNLLVNADCQLKVCDFGLARGYSE
NPVENNQFLTEYVATRWYRAPEIMLSYQGYTKAIDVWSCGCILAELLGGKPIFKGKDYVD
QLNRILQVLGTPPEETLERIGSKNVQDYIHQLGYIPKVPFVTLYPRANAQALDLLERMLT
FDPQKRITVEEALEHPYLSIWHDPADEPVCAEKFDFNFESVNEMEDLKQMILDEVRDFRR
FVRQPLIEEEQNQQEQQNQQEQQQLHQQQLEQERQSQRFMANEPTITDPYADGDFKQHVL
FSQPPSVSAELHDQFIGIHSDNLPGHDTDFPPRPQENLLMSPMGLEGAGDTNSLEPAGSL
DDFLDLEKELEFGLDRKFP
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atggtggagagcttagaaagacacacttttaaagtcttcaatcaggacttcaccgtggat
aagcgctttcagctcatcaaagagatcggacatggtgcgtacggaatcgtatgttccgct
agattcgtagaggcagcggaagagacaaacgttgctatcaagaaagttacgaatgtcttc
gccaaaacactgctgtgcaaaaggtccttgcgagaacttaaactactgcggcactttagg
ggtcacaaaaacattacttgtctgtacgacatggacatagtgttctcaccagacaattcc
ttcaatggtctgtacttgtatgaggagctgatggaatgcgacatacatcaaattattaaa
tctgggcagcctctgacggacgcgcactatcaaagttttatttaccagatactctgcgct
ctgaaatacatacactccgctgacgtcttgcatcgtgacttaaaaccaggtaaccttctg
gtgaacgcagactgccagttgaaggtttgtgattttggcttagccagaggatattccgag
aatcctgtcgaaaataaccaatttttgacggaatacgtggctacaaggtggtatagagcg
cccgaaattatgctgagctatcaaggctatacaaaggctatagatgtttggtcatgcggc
tgcattttggctgagctattaggtgggaaacccatcttcaaaggaaaagactacgttgat
caactcaaccggatacttcaggttctcggcaccccccctgaggagacgttagagagaatc
ggctccaaaaatgtgcaagattacatccatcaactgggttacatccccaaggttccgttt
gtgacgctatatccacgcgccaacgcccaagcgttggacttgcttgaaaggatgcttacg
tttgatcctcaaaagcggatcacagtggaggaagctctggagcatccatacctcagcata
tggcatgaccctgccgacgagccagtgtgtgccgaaaagtttgatttcaattttgagtcc
gtgaatgagatggaggacttgaaacaaatgattcttgacgaagttcgagacttccgccga
ttcgtcagacaaccgttaatagaagaagagcaaaaccaacaggagcagcaaaaccaacag
gagcagcaacaattacatcagcagcagctcgaacaagagcggcaaagccagcgatttatg
gcgaacgagcccactataacagatccctatgcagatggcgattttaaacagcatgtgctt
ttctcacaacctccctcggtttcggcagaactgcacgatcaattcattggtattcattcc
gataatcttcccggccatgatacagattttccgccgcggccacaggaaaatctcctcatg
tcacctatgggcttagaaggtgctggagacactaactctttggagccagcaggatctcta
gatgactttttggatttagagaaagagctagagtttggtctagatcgcaaattcccttag

DBGET integrated database retrieval system