KEGG   Lachancea thermotolerans: KLTH0G06974gHelp
Entry
KLTH0G06974g      CDS       T01117                                 

Definition
KLTH0G06974p
Orthology
K04464  
mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
lth  Lachancea thermotolerans
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:lth00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    KLTH0G06974g
Enzymes [BR:lth01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     KLTH0G06974g
Protein kinases [BR:lth01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [Table]
   KLTH0G06974g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
G:556626..558125
Genome map
AA seq 499 aa AA seqDB search
MVESLERHTFKVFNQDFTVDKRFQLIKEIGHGAYGIVCSARFVEAAEETNVAIKKVTNVF
AKTLLCKRSLRELKLLRHFRGHKNITCLYDMDIVFSPDNSFNGLYLYEELMECDIHQIIK
SGQPLTDAHYQSFIYQILCALKYIHSADVLHRDLKPGNLLVNADCQLKVCDFGLARGYSE
NPVENNQFLTEYVATRWYRAPEIMLSYQGYTKAIDVWSCGCILAELLGGKPIFKGKDYVD
QLNRILQVLGTPPEETLERIGSKNVQDYIHQLGYIPKVPFVTLYPRANAQALDLLERMLT
FDPQKRITVEEALEHPYLSIWHDPADEPVCAEKFDFNFESVNEMEDLKQMILDEVRDFRR
FVRQPLIEEEQNQQEQQNQQEQQQLHQQQLEQERQSQRFMANEPTITDPYADGDFKQHVL
FSQPPSVSAELHDQFIGIHSDNLPGHDTDFPPRPQENLLMSPMGLEGAGDTNSLEPAGSL
DDFLDLEKELEFGLDRKFP
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atggtggagagcttagaaagacacacttttaaagtcttcaatcaggacttcaccgtggat
aagcgctttcagctcatcaaagagatcggacatggtgcgtacggaatcgtatgttccgct
agattcgtagaggcagcggaagagacaaacgttgctatcaagaaagttacgaatgtcttc
gccaaaacactgctgtgcaaaaggtccttgcgagaacttaaactactgcggcactttagg
ggtcacaaaaacattacttgtctgtacgacatggacatagtgttctcaccagacaattcc
ttcaatggtctgtacttgtatgaggagctgatggaatgcgacatacatcaaattattaaa
tctgggcagcctctgacggacgcgcactatcaaagttttatttaccagatactctgcgct
ctgaaatacatacactccgctgacgtcttgcatcgtgacttaaaaccaggtaaccttctg
gtgaacgcagactgccagttgaaggtttgtgattttggcttagccagaggatattccgag
aatcctgtcgaaaataaccaatttttgacggaatacgtggctacaaggtggtatagagcg
cccgaaattatgctgagctatcaaggctatacaaaggctatagatgtttggtcatgcggc
tgcattttggctgagctattaggtgggaaacccatcttcaaaggaaaagactacgttgat
caactcaaccggatacttcaggttctcggcaccccccctgaggagacgttagagagaatc
ggctccaaaaatgtgcaagattacatccatcaactgggttacatccccaaggttccgttt
gtgacgctatatccacgcgccaacgcccaagcgttggacttgcttgaaaggatgcttacg
tttgatcctcaaaagcggatcacagtggaggaagctctggagcatccatacctcagcata
tggcatgaccctgccgacgagccagtgtgtgccgaaaagtttgatttcaattttgagtcc
gtgaatgagatggaggacttgaaacaaatgattcttgacgaagttcgagacttccgccga
ttcgtcagacaaccgttaatagaagaagagcaaaaccaacaggagcagcaaaaccaacag
gagcagcaacaattacatcagcagcagctcgaacaagagcggcaaagccagcgatttatg
gcgaacgagcccactataacagatccctatgcagatggcgattttaaacagcatgtgctt
ttctcacaacctccctcggtttcggcagaactgcacgatcaattcattggtattcattcc
gataatcttcccggccatgatacagattttccgccgcggccacaggaaaatctcctcatg
tcacctatgggcttagaaggtgctggagacactaactctttggagccagcaggatctcta
gatgactttttggatttagagaaagagctagagtttggtctagatcgcaaattcccttag

DBGET integrated database retrieval system