KEGG   Lachancea thermotolerans: KLTH0G07304gHelp
Entry
KLTH0G07304g      CDS       T01117                                 

Definition
KLTH0G07304p
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
lth  Lachancea thermotolerans
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:lth00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    KLTH0G07304g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
G:585983..591001
Genome map
AA seq 1672 aa AA seqDB search
MMEWATAPFEVVYTSIETDTFDTSKYEEVLPDLKTLNVLDGKAKNSASRAQLEKGQIKVP
SGDTYQINQEFAIAAITLSDELNLDELLTAEIMLQNCDLDSVSENSVISLVNDAKVAFYV
RRQYILQIVSFITNCCSSEDKVYIDLVSDGTLAKNIIPAFKQIESQLGEIKVLVNKSAIL
ESYDTFAQQNVRFRRDFLLKEYDTLSQILYGLVKNGTLMKKDMLLELINCASMMDSGDFF
IIYFLPALFLAISQLHLLPDGHVREMHQTLLLELESDTISVQPVKASLIFAFLAFFIGWC
KAAPSQRAKSFNFATDVDEPMTKAVELGAIEQLMAFAADTSELDKDESIELFYDIRSLLE
RHIPRLYLKQLVDGDQPSPDAINNQRLLTNASMSQQSLSFFLSAFHHLLQVVITDCAFLL
TKMKDAEEDSLLSGEDLFLDEISAKADLERFFITVHYFYAFRPDYSAVFWQDKESNAYGF
IEWAMKCTDTLMRSCVFMMLSSLSFGPENSANVYHYVNLNANLSWNTVSQLISDYIVKIS
ELERKLLDGQQRDREEQDPTTIALKTGLNEEVIILLSSLYTLIGCVAHDLNEGAKAQLSS
LFTDILFEFVKVDTPLVGAALKVLSNLVPYDELERSKFWFNLDSWIFKGFRLTISDDSYR
EAFESILTHFQDITGFLQLLNSLLKVRTKSTNGYLEFGLLQFPPKLGHGYRKLGIWPYFD
YVFHGILAQSNKLPNPAERAAIHKPILEILSSALSSFDYSVILNSIPSGSNLDELVVTDN
FLTYAMESSTTAVLNYLFEENVFKNLLQNASFGVEKMGSITEEDCQSLALPCLALSTINQ
VLTIQETYVEELCPIVKKSASKNYFIPKDFGLHGLRSFYDAISFDLPLIVGIGLYVGHTN
YKIASNSLDILDKISTEMKGRDSQAIVKDKLLSVFDSVDESARIKQAFINQLQTSITNYE
SFSIKMRILDFISKNLSYTDKQPTVAHFLLGLQIGNTISLGPDLSTFVTSGCSVLTSIIY
LLQSSLMVLSSEEIEFLPAKLASSSMEILLKLCKNSATSKIVLRHMSESDFFETILARDP
KVDVNTRWSGEVFAGNSAGDSLGFIKQTSTGAFLSFLSYRSFALQYLSLDIHGLSGESLK
SRIKSRIDLLISNYLQPPRLFSFLDALNFDARPSPHETLKGLKVLSGINFNLPSLQKVTP
CTELIYDCSELESLIRLRTQFLGKHLPLNFHEETITNKETLDRISGAEAATIEKHLTDYM
SFEQFKSLQLSLLHSWVQLVQVVVLDGALPQVSISDFILRLFEAIVPKINDYVELDVCYS
EELVSLCVFLYDLYQKDQKLNNGEHTADGRLIALFLACINGIRSPLSTLALRSDFYILAN
RFLVSIMKEVNTAKQVLKTLKLTSERLVEVVCNDAISGEGSSRITGILFLDSLVQIAGLN
KVNFVLESLVKSNMLLLISHSIKTTDDLLSSGLEGITLDNLLYELTAFKSTIHFLIRIAE
SRSGAQALVENEIFRVIESCEFLEADPDLGLELIFTEVRTQESQAVRVTFSLDKSLNLSK
DACGLSLFEIIVPVFQLMTSILISMGSANKPVLKKTRNLLIHFRKLVQGVLKRDALIEGS
DEKHLDRSNSEGLQKLVKLVVLLCTLTGYNGGSQKNGLDPKIYTLPQSYGNK
NT seq 5019 nt NT seq  +upstreamnt  +downstreamnt
atgatggagtgggccacggcaccattcgaggttgtctatacgtctatcgagaccgacacc
ttcgatacatccaaatatgaagaagtcttgcccgatttaaagacactcaatgtactagat
ggtaaagcaaagaatagcgccagcagagctcaattagaaaagggccaaataaaggtcccc
tcgggggatacctaccaaattaaccaagagtttgcaatcgccgcaataacattgtcagac
gagctcaatctcgatgagctgttgaccgcagagataatgttgcaaaactgtgatctggat
tcagtaagcgagaattctgtgatcagtttggtcaatgacgcgaaagtggccttttatgtt
agaaggcagtatatccttcaaattgtatcctttatcacaaactgttgcagttctgaagat
aaggtttacatcgacctagtatctgacggaactttagcaaagaatataattcccgctttc
aaacaaatagagagtcagctcggggaaattaaagttctagtgaacaaatccgcgatactg
gaaagctacgatacgtttgctcaacaaaatgttcgctttagaagggactttctcctcaag
gaatacgataccctaagtcaaattctatatggcttagtcaagaacggcactctcatgaaa
aaggatatgctgcttgagctgatcaattgtgcctcaatgatggactcaggcgactttttc
atcatttactttctacctgcattgtttttggctatctcccagcttcaccttctccccgac
ggtcacgttcgagaaatgcaccaaactcttcttctcgagcttgaaagtgatacgataagc
gtacagcctgttaaagcctctctaatttttgcatttctggcattctttataggatggtgc
aaagcagcaccctctcaaagagccaaatcttttaacttcgccacagacgtcgatgaacca
atgacaaaagcggtagaattgggcgcgattgagcagctaatggcatttgctgcggacacc
tctgagctagacaaagacgaaagcatagagctcttttacgatatcagatctttgttagag
agacatattccgagactttatctcaaacaacttgttgatggggaccagccatctcccgat
gccatcaacaaccagcgattgctcacaaatgcttcaatgtcacaacaaagcttgtctttt
tttctttcggccttccatcatttattacaagttgtgataactgattgcgcttttcttcta
acaaagatgaaagatgctgaagaggattctcttctttctggagaagatctgtttttggac
gaaatatccgcgaaggctgatctcgaacgattcttcattactgtacattacttttatgca
ttcagacctgactactctgcagtattttggcaagataaagaatctaatgcatacgggttc
attgagtgggcaatgaagtgcacagacacacttatgagatcttgtgtgttcatgatgctg
tcgagcctttcatttggcccagaaaattcggcgaatgtctaccactatgtgaatctcaat
gccaatctctcctggaatacagtttcgcaacttattagcgactacatcgtgaaaatttcc
gagttggaaaggaaacttctcgatggccagcagagagatcgggaagaacaggatcccact
accatagccctcaaaaccggacttaatgaagaggtcatcatccttctctcatcactgtac
actttgattggatgcgtggcccatgacttgaacgagggagcaaaggcgcaactctcatct
ctatttaccgacattctctttgaattcgtgaaggtcgatacacctcttgtgggtgctgca
ttaaaggtcttgagtaatcttgtcccttatgatgaacttgagaggagtaagttttggttc
aatctagactcatggatattcaaaggctttaggctcaccatctcggatgactcttaccga
gaggcttttgaaagtatcttgacccactttcaagatatcactgggttcctgcagctcttg
aatagccttttaaaagtgcgcacgaaaagcacaaacggctacctcgaatttggtcttttg
caatttcccccaaaactaggtcatggttacagaaagctgggtatttggccgtattttgat
tatgtcttccatgggatcctagctcaatccaacaaattaccaaatccggccgagcgtgcc
gctatccacaagccaattttggagatattaagcagcgctttgagctcgttcgactatagc
gtgattctgaactcaattccatcagggtccaaccttgacgaacttgttgtaactgacaac
tttctcacttacgccatggaatcttccaccacagctgttctcaattatctttttgaggaa
aatgttttcaaaaacctgcttcaaaacgcctcatttggggttgaaaaaatgggaagtata
acagaggaagactgtcaatcactagcattaccatgcctcgccttaagcaccatcaaccaa
gttctaactattcaggaaacgtatgtggaagagctctgtccaattgtaaagaaaagtgca
agtaagaattactttattccaaaagactttggtttacatggtctgcgctcattctacgac
gctatttcttttgatcttcctttgattgtcggtatcggtctctatgttggtcacactaac
tataagattgcatccaactcgcttgatatcttagacaagatatctacagaaatgaaaggt
agagatagccaagccattgtcaaagacaaactcctcagcgttttcgattcagttgatgaa
tctgcgcggataaaacaagccttcatcaatcaattacaaacttcaattaccaattatgaa
agtttctctattaaaatgagaatccttgattttatctcaaagaacttgtcatacacagac
aagcagccaacagtcgcacacttcctattaggtttacaaataggcaatacaatatcgtta
ggccccgatttgagcacattcgttacttccggttgttctgttttgacgtcaatcatatac
ctgcttcaatcttccctgatggttctgagttcagaagaaatcgaatttctcccagctaag
ttagcatcttcatcaatggaaattcttttgaagttatgcaagaattctgcaacttcaaaa
atagtcttgagacatatgagtgagtctgatttcttcgaaacaatactcgctcgtgaccca
aaggtcgacgttaacacaagatggtccggtgaggttttcgccggaaattcggctggcgac
tctcttggattcatcaaacagacttcaactggtgcatttttgtcttttctaagctacagg
agttttgcgttacagtatttgagtcttgacattcacggattgagtggcgagtcactcaaa
agcagaataaaatcaagaattgatctcctaatttcgaattacctacaaccacctcgtcta
ttttcgtttcttgatgccctaaacttcgacgccaggccttcgcctcacgagactttaaaa
ggcttgaaagtcctctcagggataaattttaacctgccttccttacaaaaagtcacacct
tgtacagaattgatttacgattgcagtgaacttgaatcactcattcgcttaaggacgcaa
tttttagggaagcatctacccttgaactttcatgaggaaacaatcacaaacaaggagacg
ctcgatagaatttcaggtgcagaggccgcgactattgaaaagcacctgacagattatatg
agctttgagcagttcaaatccttacaactttctctactacactcttgggttcaacttgtt
caagtggttgtgctagatggagccctcccacaagtgtcaatttcagactttattttacga
ctctttgaagccattgttccaaagatcaatgattacgtcgagcttgatgtgtgctattcg
gaagagcttgtttccttatgcgtgttcctttacgatctttaccagaaagaccaaaagctg
aataatggcgagcacacagccgatgggcgcctaatagctttgtttttggcttgtattaat
ggcatacgatctccgctttccactttggctcttaggtctgatttttacatccttgctaac
cgtttcctagttagcatcatgaaagaagttaacacggcaaaacaagttctcaaaacactg
aaactgaccagtgaacggctcgttgaagtggtctgcaatgatgcaatctcaggcgaggga
tcctctagaattactggtattttattcctggattcactggttcaaattgctggtctcaat
aaggtgaatttcgtcttagaaagccttgtcaaaagtaacatgctcctcctcatcagtcac
tcaatcaagactactgatgacctcctgagctcagggctagaaggtattactctggacaac
ctactatatgagctgactgccttcaagtcaaccattcatttccttatccgcatagctgaa
tcacgaagcggagcacaggctttggtggaaaatgagattttccgtgtcatagagtcttgt
gaattcttagaggccgatccagatttaggacttgaactaattttcactgaagtcaggact
caagagtcgcaggcagtccgcgtgacctttagcttggacaaatctttaaacctcagcaaa
gatgcttgcggtttatcgctgttcgagattatcgtcccagtgttccaactaatgacgtct
atcctcataagcatgggtagtgcaaataagcctgttctcaagaaaacaaggaatctttta
attcacttcaggaagcttgtgcagggtgttctaaagagagatgctcttattgaaggtagc
gacgaaaaacatttggaccgttctaatagtgagggcttacaaaaacttgtaaagcttgtt
gtcctgctttgtaccttgactggctataatggagggtcacaaaagaacggcttggatccc
aaaatatacacgttgcctcagtcatatggaaacaagtag

DBGET integrated database retrieval system