KEGG   Lachancea thermotolerans: KLTH0G07392gHelp
Entry
KLTH0G07392g      CDS       T01117                                 

Definition
(RefSeq) KLTH0G07392p
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
lth  Lachancea thermotolerans
Pathway
lth00010  Glycolysis / Gluconeogenesis
lth00260  Glycine, serine and threonine metabolism
lth00680  Methane metabolism
lth01100  Metabolic pathways
lth01110  Biosynthesis of secondary metabolites
lth01130  Biosynthesis of antibiotics
lth01200  Carbon metabolism
lth01230  Biosynthesis of amino acids
Module
lth_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
lth_M00002  Glycolysis, core module involving three-carbon compounds
lth_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:lth00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KLTH0G07392g
  Energy metabolism
   00680 Methane metabolism
    KLTH0G07392g
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    KLTH0G07392g
Enzymes [BR:lth01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     KLTH0G07392g
Membrane trafficking [BR:lth04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    KLTH0G07392g
Exosome [BR:lth04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   KLTH0G07392g
  Exosomal proteins of melanoma cells
   KLTH0G07392g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-GeneID: 8293629
NCBI-ProteinID: XP_002555359
UniProt: C5DMB1
Position
G:complement(599733..600476)
Genome map
AA seq 247 aa AA seqDB search
MPKLVLVRHGQSEWNEKNLFTGWVDVRLSAIGEKEAARAGELLKEKNVKPDILFTSKLSR
AIQTANIALSAADRLWIPTVRSWRLNERHYGALQGKDKAATLAEYGEEQFTTWRRSFDVP
PPTIADSSEYSQTNDERYKDVDPSAVPKTESLALVIDRLLPYWQDTISKELLEGKTVMIA
AHGNSLRALVKHLEGISDTDIAKLNIPTGIPLVFELDEKLKPTKPSYYLDPEAAAAGAAA
VANQGKK
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgccaaagctagtcctagttagacacggtcaatccgaatggaacgagaagaaccttttc
accggctgggtggacgttagattgtccgccatcggtgagaaggaggccgcccgtgctggt
gagcttttgaaggagaagaacgtcaagccagacattctgttcacctctaagctgtccaga
gccatccagaccgccaacatcgccttgagcgctgccgacagattgtggatcccaaccgtt
agatcctggaggttgaacgagagacactacggtgctctgcagggtaaggacaaggccgcc
accttggccgagtacggtgaggagcaattcaccacctggagaagatccttcgatgtccca
cctccaaccatcgccgacagctccgagtactctcagaccaacgacgagagatacaaggac
gtcgacccaagcgccgtcccaaagaccgagtccttggctttggtcatcgacagattgttg
ccatactggcaagacaccatctccaaggagttgttggagggcaagaccgttatgatcgct
gctcacggtaactctttgagagctttggttaagcacttggagggcatctccgacaccgac
atcgccaagttgaacatcccaactggtatcccattggtcttcgagttggacgagaaattg
aagccaaccaagccatcttactacttggacccagaggccgctgccgccggtgccgccgct
gttgccaaccaaggtaagaaataa

DBGET integrated database retrieval system