KEGG   Lachancea thermotolerans: KLTH0G07392gHelp
Entry
KLTH0G07392g      CDS       T01117                                 

Definition
KLTH0G07392p
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
lth  Lachancea thermotolerans
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:lth01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:lth01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:lth00010]
Metabolism; Energy metabolism; Methane metabolism [PATH:lth00680]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:lth00260]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
G:complement(599733..600476)
Genome map
AA seq 247 aa AA seqDB search
MPKLVLVRHGQSEWNEKNLFTGWVDVRLSAIGEKEAARAGELLKEKNVKPDILFTSKLSR
AIQTANIALSAADRLWIPTVRSWRLNERHYGALQGKDKAATLAEYGEEQFTTWRRSFDVP
PPTIADSSEYSQTNDERYKDVDPSAVPKTESLALVIDRLLPYWQDTISKELLEGKTVMIA
AHGNSLRALVKHLEGISDTDIAKLNIPTGIPLVFELDEKLKPTKPSYYLDPEAAAAGAAA
VANQGKK
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgccaaagctagtcctagttagacacggtcaatccgaatggaacgagaagaaccttttc
accggctgggtggacgttagattgtccgccatcggtgagaaggaggccgcccgtgctggt
gagcttttgaaggagaagaacgtcaagccagacattctgttcacctctaagctgtccaga
gccatccagaccgccaacatcgccttgagcgctgccgacagattgtggatcccaaccgtt
agatcctggaggttgaacgagagacactacggtgctctgcagggtaaggacaaggccgcc
accttggccgagtacggtgaggagcaattcaccacctggagaagatccttcgatgtccca
cctccaaccatcgccgacagctccgagtactctcagaccaacgacgagagatacaaggac
gtcgacccaagcgccgtcccaaagaccgagtccttggctttggtcatcgacagattgttg
ccatactggcaagacaccatctccaaggagttgttggagggcaagaccgttatgatcgct
gctcacggtaactctttgagagctttggttaagcacttggagggcatctccgacaccgac
atcgccaagttgaacatcccaactggtatcccattggtcttcgagttggacgagaaattg
aagccaaccaagccatcttactacttggacccagaggccgctgccgccggtgccgccgct
gttgccaaccaaggtaagaaataa

DBGET integrated database retrieval system