KEGG   Lachancea thermotolerans: KLTH0G07436gHelp
Entry
KLTH0G07436g      CDS       T01117                                 

Definition
KLTH0G07436p
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
lth  Lachancea thermotolerans
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lth00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    KLTH0G07436g
Enzymes [BR:lth01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     KLTH0G07436g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
G:603006..603884
Genome map
AA seq 292 aa AA seqDB search
MFSRVLRSRSAIPLAVGSVTIAAAFYHSTLIRNEPLKTFTGDDSWVELPIAKIEEVSHDT
RRFIFSLPQEEQVSGLVVASALLAKLQTPKGSNVIRPYTPVSDVSTKGHIEFVIKHYNGG
KMTEMLFDKKPSDTVAFKGPIPKWEWKPNSFDSITLLGAGSGITPLYQLVHHISQDPKDK
TKVHLLYGNKTPNDILLKRELDAIQAKYPDQVKIHYFVDKAEGSFDGHTGFITKEYLEKN
VPKASEKNQVFVCGPPPFMKAYSGPKASPKDQGELTGILKDLGFTKESVFKF
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgttctctagagtcctaagatccagaagcgctatcccactagccgtgggatcggtcacg
atcgctgctgcgttctaccactccaccttgattagaaacgagcctctcaagacgttcacc
ggcgacgacagctgggtggagctgcctattgctaagatcgaggaggtgtcgcacgacacg
cgccgcttcatcttcagcctaccccaggaagagcaggtttcgggcctggttgtagcatca
gctttgctggccaagttgcagacgcctaagggctccaacgtgattagaccctacacgccc
gtcagcgacgtgtccaccaagggccacatcgagttcgtcatcaagcactacaacggtggc
aaaatgaccgagatgctgttcgacaagaagccctccgacaccgtggcgttcaagggccca
attcctaagtgggagtggaagccaaactccttcgactccatcaccctgctgggcgccggg
tccggtatcacgccgctgtaccagctggtgcaccacatctcgcaggaccctaaggacaag
accaaggtccacctgctgtacggtaacaagacccctaacgacatcctgctgaagagggag
ctcgacgccattcaggccaagtaccctgaccaagtcaagatccactacttcgtcgacaag
gccgagggctccttcgacggccacacgggattcatcaccaaggaatacttggagaagaac
gtgccaaaggcgtccgagaagaaccaggtcttcgtttgcggtcctcctccattcatgaag
gcctactctggccccaaggcttctccaaaagaccagggcgagctgactggtatcctgaag
gacctgggcttcaccaaagaaagcgttttcaagttctga

DBGET integrated database retrieval system