KEGG   Lachancea thermotolerans: KLTH0G08998gHelp
Entry
KLTH0G08998g      CDS       T01117                                 

Definition
(RefSeq) KLTH0G08998p
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
lth  Lachancea thermotolerans
Pathway
lth00010  Glycolysis / Gluconeogenesis
lth00020  Citrate cycle (TCA cycle)
lth00620  Pyruvate metabolism
lth01100  Metabolic pathways
lth01110  Biosynthesis of secondary metabolites
lth01130  Biosynthesis of antibiotics
lth01200  Carbon metabolism
Module
lth_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:lth00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KLTH0G08998g
   00020 Citrate cycle (TCA cycle)
    KLTH0G08998g
   00620 Pyruvate metabolism
    KLTH0G08998g
Enzymes [BR:lth01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     KLTH0G08998g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl
Motif
Other DBs
NCBI-GeneID: 8293700
NCBI-ProteinID: XP_002555423
UniProt: C5DMH5
Position
G:734671..736086
Genome map
AA seq 471 aa AA seqDB search
MSSFIRTVPRIRSAVLRSARLQLRTYASSYPPHTVIGMPALSPTMTQGNIAVWNKQVGDK
LEPGEAIAEIETDKAQMDFEFQEDGFLAKILEPAGAKDLPVGKPIAVYVEEEGDVAAFKD
FKVEETAPAKSEKPVADAKPAEDNKSAKDDKPAKKPSASKQAASGKPAGDRIFASPLAKN
IALQHGVALKSVTGTGPHGRITKSDVEEFLSKSPAASAGGSAAAGTAAAAAAPAGPGAQY
EDIPISNMRKIIGDRLLESTSGTPAYIVSSQISVSKLLKLRQSLNASGKDQYKLSVNDML
IKAVTVAAQRVPDANAYWLANEGVIRKFKNVDVSVAVATPNGLLTPIVKNAHAKGLVSIS
SEIKELGKRAKINKLKPEEFQGGTICISNLGMNNAVSMFTSIINPPQSTILAIGTVQRVP
VEDAGAEYGFIFEDKINITGTFDHRTIDGARAGDFMRELKKVVENPLEMLL
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgtccagtttcattcgcacagtaccccggattagaagcgcagtgctgcgcagcgcaaga
ctgcagctgcggacgtacgcgtcgtcgtacccaccacacacagtgatcgggatgcctgcg
ctgtcgcccacgatgacgcagggcaacatcgcggtgtggaacaagcaggtgggcgacaag
ctggaacccggcgaggccatcgcggaaatcgagaccgacaaggcgcagatggacttcgag
ttccaggaagacgggttcctggccaagatcctggagcctgcgggcgccaaggacctaccc
gtgggcaagcccatcgccgtgtacgtggaggaggagggcgacgtggccgcgttcaaggac
ttcaaggtcgaggagaccgcgcccgccaagagcgagaagcctgtcgcggacgccaagcct
gctgaggacaataagtccgccaaggatgacaagcccgccaagaagcctagcgcctcgaag
caggccgcctcgggcaagcctgccggcgaccgcatcttcgcgtcgccactggccaagaac
atcgcgctgcagcacggtgtcgcgctcaagtccgtcacgggcaccggtccccacggcaga
atcaccaaatccgacgtcgaggagttcctgagcaagtctccagcggcctctgcaggtggc
tcggccgccgcgggcactgcggccgctgctgccgcgccagcgggccctggcgctcagtac
gaggacatccctatctccaacatgagaaagatcattggcgaccgtctgctcgagtccact
tccggcacccccgcctacatcgtgtcctcgcagatctcagtctccaagctgctaaagctc
agacagtcgctcaacgcctctggcaaggaccagtacaagctctctgtcaacgacatgctg
atcaaggctgtcaccgtggctgcacaaagagtgcctgacgccaacgcctactggctggcc
aacgagggcgtgatccgcaagttcaagaacgtcgatgtctccgtcgctgtcgctacgccc
aacggcctcctgacccctattgtcaagaacgcccacgccaagggcctcgtctccatctct
tctgagatcaaggagctcggcaagcgtgccaagatcaacaagttgaagcctgaggagttc
cagggcggtaccatctgcatttccaacctgggtatgaacaacgccgtttccatgttcacc
tccatcatcaacccaccccagtctaccattctggccattggcaccgtgcagagagttcct
gtggaggacgctggcgctgaatacggcttcatcttcgaagacaagatcaacatcaccggt
acctttgaccacagaaccatcgacggcgcccgcgctggcgacttcatgagggaactcaag
aaggtggtcgagaaccctctcgagatgctgctataa

DBGET integrated database retrieval system