KEGG   Lachancea thermotolerans: KLTH0G10142gHelp
Entry
KLTH0G10142g      CDS       T01117                                 

Definition
KLTH0G10142p
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
lth  Lachancea thermotolerans
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lth00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    KLTH0G10142g
Enzymes [BR:lth01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     KLTH0G10142g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
G:858744..860582
Genome map
AA seq 612 aa AA seqDB search
MGKNQCEQGFRDGARRKWPRISLLTLGAGYLLWVFLYNSDAPSTSGGAGPRGRANFATGQ
PATTHNVTISNFNPQGSVSPTSAPDYSYYQQRIQLRPLISSTVARDEFEAWLQKQTTVSF
ERLLANIGDVELNNLSSTDGVAEGGVIASPSKQAPNYFYQWVRDSAITINTVVSHISNSS
QSSGLNLTLVGTVLKYINNSCILQRTANPSGSLQPELEGLGEPKWEVDDSAFTGSWGRPQ
SDGPPLRAITTLNFLSTLNQSGHSLENVIDLYQKEFKTDLRLSFQSERELIEQALALDLN
FVVKNWRKSGFDLWEEVNGQHFFTALCQLKAVSLGRNYYTNIRPEFDNEQKSISGGLHNS
FEDILNFLLVDGGFLNPAKNYIVETPQILGQRSGLDIAILIGSLLTHDSEENSPNSEKFP
FDVNDSGILNSLYGLVKQMEILYPVNHQRANLNLGVALGRYPEDIYNGVDTSEGNPWFLA
TSAAAEVLYKVIWHYQSLNQDLVIPLDGWQSEFWSLIFERIDFSLQGQDTWQLVIPYHSP
AYNQTMVSLFTLGDSFLDKVREHVSDEGEMSEQFNRYTGFLQGARHLTWSYGAFWSSRRW
RDQALKALNAPN
NT seq 1839 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaaaatcagtgcgaacaaggtttccgcgatggagctcggcgcaagtggccaagg
atttcgcttctcacgctgggtgccggctacttattgtgggttttcctctacaactccgac
gccccctcgaccagtggcggcgccgggccccgaggccgtgcgaatttcgcgacgggccag
cccgccactacgcacaacgttactatatcgaatttcaatccgcaaggctctgtaagccca
acgtcggcccccgattactcctactaccagcagcggatccagctgcgacccttgatttcg
tccaccgtcgctcgcgacgagttcgaggcctggcttcagaagcagaccacggtgagcttc
gaaaggctgctagccaacattggcgacgtcgagctcaacaacctctcgagcactgacggc
gtggctgaggggggcgtaatcgcgtctccttcgaagcaggcacccaactacttctaccag
tgggtcagagacagcgccatcaccatcaacactgtggtgagccacatctcgaattcctcc
cagagctccggcctgaacttgaccttggtgggcaccgtgctcaaatatatcaacaattct
tgtatcttgcaaagaacagcgaacccatcgggctctctgcagccagagcttgaggggcta
ggggagcccaaatgggaggttgatgactctgcgttcaccggcagctggggccgcccgcag
agcgacgggcccccactgcgcgctattaccactctcaacttcctaagcacccttaatcaa
tcggggcactcgctggaaaacgtcatcgacttgtaccagaaagagttcaaaaccgatcta
agactgtcattccaaagtgagcgcgaattaattgagcaagcactggcgctggacctaaat
tttgtggttaaaaattggcgcaaaagtggttttgatctgtgggaagaagttaacggccaa
cactttttcacggcgctgtgccagctaaaggctgtcagtttgggccggaattattacaca
aatattcggcctgagtttgacaacgaacagaaatctatttcgggcgggctgcacaatagc
tttgaggatatccttaatttcttgttggtcgatggaggttttctaaatccggccaaaaac
tacatagtcgagaccccccaaatactgggtcaacgctccggattggacattgcaattctc
ataggatcattattgacacacgactccgaagaaaactcacccaattcagaaaaatttccc
tttgacgtgaatgatagtggcattttgaattccttgtatggcttggtgaagcaaatggaa
atcctgtacccggtcaatcaccaaagggccaatctcaaccttggcgttgcacttggcaga
taccctgaggacatttacaacggcgtggacacatctgagggaaacccatggttcttggca
acatctgcagccgccgaagttctttataaagtcatatggcactaccaaagcctgaatcaa
gacctagtgatccccctggatggctggcagtccgaattctggagcctgatatttgagagg
attgacttctcattgcagggccaagacacctggcaactggtgattccttatcactcaccc
gcttacaatcagactatggtttcgttatttacactaggagactcatttctagacaaggtc
agagagcacgtgagcgatgagggtgagatgtctgagcagttcaatagatacactggtttc
ttgcagggtgcgagacacctgacatggtcttacggcgcattctggagttcgcgccgctgg
agagaccaggcactcaaggcgctcaacgcgcccaactaa

DBGET integrated database retrieval system