KEGG   Lachancea thermotolerans: KLTH0G10186gHelp
Entry
KLTH0G10186g      CDS       T01117                                 

Definition
(RefSeq) KLTH0G10186p
  KO
K00030  isocitrate dehydrogenase (NAD+) [EC:1.1.1.41]
Organism
lth  Lachancea thermotolerans
Pathway
lth00020  Citrate cycle (TCA cycle)
lth01100  Metabolic pathways
lth01110  Biosynthesis of secondary metabolites
lth01130  Biosynthesis of antibiotics
lth01200  Carbon metabolism
lth01210  2-Oxocarboxylic acid metabolism
lth01230  Biosynthesis of amino acids
Module
lth_M00009  Citrate cycle (TCA cycle, Krebs cycle)
lth_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:lth00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    KLTH0G10186g
Enzymes [BR:lth01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.41  isocitrate dehydrogenase (NAD+)
     KLTH0G10186g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-GeneID: 8293754
NCBI-ProteinID: XP_002555476
UniProt: C5DMM8
Position
G:863151..864233
Genome map
AA seq 360 aa AA seqDB search
MLRNGFGISKRSLATVAEQLLPKKYGGRYTVTLIPGDGVGKEVTDSVVSIFESENVPIDW
ETVEISGLDNEEGVQKAVDSLKRNKVGLKGIWHTPSDQTGHGSLNVALRKQLDIFANVAL
FKTVPGVPSRHSNVDLVVIRENTEGEYSGLEHESVPGVVESLKIMTKAKSDRIGRFAFDF
ALKNNRKSVCAVHKANIMKLGDGLFRNCINEIGAKEYPEIEVKNIIVDNASMQAVAKPHQ
FDVLVTPNLYGSILGNIGAALIGGPGLVPGANFGREFAVFEPGSRHVGLDIKGQNVANPT
AMILSSALMLRHLGLNSYADRISKATYDVIAEAKNTTKDIGGSASTTDFTQAIIEKLRAL
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgctaagaaacggttttggcatttctaagaggtcgctagcgaccgtagcagagcaactg
ctgcccaagaaatacggtggacgctacacagttacgctgatccctggtgacggtgtggga
aaggaggtcacggactccgtggtgtcgattttcgagtccgaaaacgtgccaattgactgg
gaaactgttgagatttctggtctcgacaacgaagagggagtccagaaggctgtggattcg
cttaagagaaacaaagtgggtctaaagggtatctggcacacaccttcggaccagacagga
cacggctccctcaacgtggcgctacgtaagcagctcgacatttttgccaacgttgctctt
ttcaagaccgttcccggcgtgccttcccgccactctaacgtcgacctggttgttatcaga
gagaacactgagggtgagtactctggcctggagcacgagtccgtcccaggtgtcgtcgag
tcgctaaagatcatgactaaggccaagtctgacagaatcggtcgtttcgcgtttgacttc
gccctcaagaacaacagaaagtctgtgtgcgctgttcacaaggctaacattatgaagctg
ggtgacggcctgtttagaaactgtatcaacgagatcggtgctaaagagtatcctgagatc
gaggtcaaaaacatcattgttgacaatgcttccatgcaagccgtggccaagcctcaccaa
ttcgatgttctcgttactccaaacttgtacggctccatcttgggtaacatcggcgctgcc
ttgattggcggtccaggccttgttcctggtgccaactttggtagagagttcgccgttttc
gagccaggctccagacatgtcggtttggacatcaaaggccaaaatgtcgccaacccaacc
gccatgatcttgtcgtctgccctcatgttgagacatttgggcctcaactcttacgccgac
agaatttccaaggctacttatgacgtaattgctgaagccaagaacactactaaagatatc
ggtggctccgcttcgaccacggacttcactcaggctatcatcgagaagttgagagctctt
tga

DBGET integrated database retrieval system