KEGG   Lachancea thermotolerans: KLTH0G10186gHelp
Entry
KLTH0G10186g      CDS       T01117                                 

Definition
KLTH0G10186p
Orthology
K00030  
isocitrate dehydrogenase (NAD+) [EC:1.1.1.41]
Organism
lth  Lachancea thermotolerans
Pathway
Citrate cycle (TCA cycle)
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Class
Metabolism; Overview; Carbon metabolism [PATH:lth01200]
Metabolism; Overview; 2-Oxocarboxylic acid metabolism [PATH:lth01210]
Metabolism; Overview; Biosynthesis of amino acids [PATH:lth01230]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:lth00020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
G:863151..864233
Genome map
AA seq 360 aa AA seqDB search
MLRNGFGISKRSLATVAEQLLPKKYGGRYTVTLIPGDGVGKEVTDSVVSIFESENVPIDW
ETVEISGLDNEEGVQKAVDSLKRNKVGLKGIWHTPSDQTGHGSLNVALRKQLDIFANVAL
FKTVPGVPSRHSNVDLVVIRENTEGEYSGLEHESVPGVVESLKIMTKAKSDRIGRFAFDF
ALKNNRKSVCAVHKANIMKLGDGLFRNCINEIGAKEYPEIEVKNIIVDNASMQAVAKPHQ
FDVLVTPNLYGSILGNIGAALIGGPGLVPGANFGREFAVFEPGSRHVGLDIKGQNVANPT
AMILSSALMLRHLGLNSYADRISKATYDVIAEAKNTTKDIGGSASTTDFTQAIIEKLRAL
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgctaagaaacggttttggcatttctaagaggtcgctagcgaccgtagcagagcaactg
ctgcccaagaaatacggtggacgctacacagttacgctgatccctggtgacggtgtggga
aaggaggtcacggactccgtggtgtcgattttcgagtccgaaaacgtgccaattgactgg
gaaactgttgagatttctggtctcgacaacgaagagggagtccagaaggctgtggattcg
cttaagagaaacaaagtgggtctaaagggtatctggcacacaccttcggaccagacagga
cacggctccctcaacgtggcgctacgtaagcagctcgacatttttgccaacgttgctctt
ttcaagaccgttcccggcgtgccttcccgccactctaacgtcgacctggttgttatcaga
gagaacactgagggtgagtactctggcctggagcacgagtccgtcccaggtgtcgtcgag
tcgctaaagatcatgactaaggccaagtctgacagaatcggtcgtttcgcgtttgacttc
gccctcaagaacaacagaaagtctgtgtgcgctgttcacaaggctaacattatgaagctg
ggtgacggcctgtttagaaactgtatcaacgagatcggtgctaaagagtatcctgagatc
gaggtcaaaaacatcattgttgacaatgcttccatgcaagccgtggccaagcctcaccaa
ttcgatgttctcgttactccaaacttgtacggctccatcttgggtaacatcggcgctgcc
ttgattggcggtccaggccttgttcctggtgccaactttggtagagagttcgccgttttc
gagccaggctccagacatgtcggtttggacatcaaaggccaaaatgtcgccaacccaacc
gccatgatcttgtcgtctgccctcatgttgagacatttgggcctcaactcttacgccgac
agaatttccaaggctacttatgacgtaattgctgaagccaagaacactactaaagatatc
ggtggctccgcttcgaccacggacttcactcaggctatcatcgagaagttgagagctctt
tga

DBGET integrated database retrieval system