KEGG   Lachancea thermotolerans: KLTH0G10340gHelp
Entry
KLTH0G10340g      CDS       T01117                                 

Definition
KLTH0G10340p
Orthology
K11407  
histone deacetylase 6/10 [EC:3.5.1.98]
Organism
lth  Lachancea thermotolerans
Brite
Enzymes [BR:lth01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     KLTH0G10340g
Protein phosphatases and associated proteins [BR:lth01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     KLTH0G10340g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
G:complement(874566..876692)
Genome map
AA seq 708 aa AA seqDB search
MTESAEVKQEEPSEQINGLKRDHESATLNDGTGNQASVAKRPTIVPACRPKLHYTPLKTG
LCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIDDPTLSGVDSIGDLML
KIPVREATDEEILQVHTKEHLEFISKTTSMTRDQLLKETEKGDSVYFNNDSYLSAKLSCG
GAIEACKAVVEGRVKNALAVVRPPGHHAEPEVAGGFCLFSNVAVAAQNILKNYPESVRKI
MVLDWDVHHGNGTQKAFYDDDRVLYISLHRHELGKYYPGTIHGNSDRVGEGKGEGFNCNI
PWPWKGVGDSEYLWAFEQVIMPMGREFRPDLVIISSGFDAADGDTVGQCHVTPSCYGHMT
HMLKSLARGNLCAVLEGGYSLDSIAKSALAVAKVLIGEPPDELPVVKQPKLEAVEVIDSV
IKTQSKYWKCFKSTHGNDGCSFKEQATDTAINKNFPLQNAIRQQQMRLLANEFRFVTLPL
FKKELPDDTAICSPNIYDASAIIVCVHDTPSIWAQRSRATGTIDPSTSIIVDTTLDVIKW
ASSRNYGVIDINIPQSLHEQDNYSAVITAQEVLVHIWDNYLKYFPSLNRVAFVAIGDAHS
GVVHLLGHRDTRSVVKSAVSFVDQRPLRPLIPLVDETLADWYFKNSLVFASAEHTCWGND
GNENKKPRKKFGRVLKCDSDGINNILEERFEEATDFILDTFEEWSDSE
NT seq 2127 nt NT seq  +upstreamnt  +downstreamnt
atgactgagagcgctgaagtcaaacaggaagagccatcagagcaaataaatggtttgaaa
agagatcacgaaagcgccacattgaacgacgggacgggaaaccaagcctcggttgccaaa
agaccaacgatagtgccagcttgccgaccaaaattacactacacccctctcaaaactgga
ctgtgttatgatgtcaggatgcgctaccatgcaaaaatctttacatcctacttcgaatac
attgatcctcatccagaggaccctaggcgaatttacagaatttacaagatattagcagaa
aacggcctaatagacgatccaaccctcagtggagttgacagtattggcgatcttatgctc
aaaattcccgttagagaggctaccgacgaggaaattttgcaagtccataccaaagagcac
ttggaatttatctccaagaccaccagcatgacaagagatcagcttctgaaggaaaccgaa
aaaggtgattctgtttacttcaacaacgactcatatcttagtgcgaaactctcatgcggt
ggcgccattgaagcttgtaaagcggtcgttgaggggcgtgtcaaaaatgcattagcagtc
gtgcggcctcctggacatcatgctgaacctgaagtggcaggtggattctgcctttttagt
aatgttgcagttgctgcgcagaacattttaaaaaactaccccgaaagcgtacgcaaaatt
atggttcttgactgggatgtccatcatggcaacggaactcaaaaagccttttacgatgac
gaccgcgtgctctacatttcacttcatagacacgagttgggaaagtactacccagggact
attcacgggaactctgacagagttggagaagggaaaggcgagggatttaattgcaacata
ccctggccctggaaaggagttggcgattccgagtatctgtgggcgtttgagcaggtgata
atgccaatggggcgtgaatttcgacccgatctagtgataatatcttcagggtttgatgct
gcggatggcgataccgttggccagtgtcacgtaactcccagctgttatgggcatatgacg
catatgctgaaatctttggccagaggcaatctttgcgccgttcttgagggtggttatagc
ttggattctattgctaaaagtgccttagcagtagccaaggttttgataggagagccacca
gacgagttgcctgtagttaaacaacccaagctcgaagccgtcgaagtgattgattccgtt
attaaaacccaatctaagtactggaagtgctttaagagtacacatggcaacgatggttgc
tcttttaaggaacaggctaccgatactgcaatcaacaaaaactttcctctacaaaacgca
atacggcagcaacaaatgcggttgttggcaaacgagttcagatttgttactttgccgctt
ttcaagaaagagctaccagacgacacagcaatctgctctccaaacatttatgatgcttcc
gcgattatagtgtgtgttcatgatactcccagcatatgggctcaaagaagtcgagccaca
ggcacaattgatccctcaacatccatcatagtcgatactacccttgatgtgataaaatgg
gcttcgagtagaaattacggagtcattgacatcaatatacctcagtcgcttcatgaacaa
gacaactactctgctgtgataacagcgcaagaggtccttgtacacatttgggataactac
ctaaaatacttcccaagccttaacagggttgcctttgttgcaataggagatgcacacagc
ggggtggttcaccttcttggtcacagggacacgaggagtgttgtcaagtcggctgtttcg
tttgttgatcaaaggccactaagaccgttgattcctcttgttgatgaaacgttagctgac
tggtattttaaaaattcactggtttttgcaagtgctgaacacacttgttggggcaacgac
ggtaatgagaacaagaaaccaagaaaaaaatttggaagagtacttaagtgcgactccgat
gggataaataacatacttgaagagaggtttgaggaggcaacagattttattcttgacact
ttcgaagaatggagcgacagcgaatga

DBGET integrated database retrieval system