KEGG   Lachancea thermotolerans: KLTH0G10934gHelp
Entry
KLTH0G10934g      CDS       T01117                                 

Definition
KLTH0G10934p
Orthology
K11870  
ubiquitin carboxyl-terminal hydrolase 1 [EC:3.4.19.12]
Organism
lth  Lachancea thermotolerans
Brite
Enzymes [BR:lth01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     KLTH0G10934g
Peptidases [BR:lth01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   KLTH0G10934g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
G:919304..921580
Genome map
AA seq 758 aa AA seqDB search
MNFVLEKLSALFSTLSIFVRNLSHIDNKSSTLIVLIASTGILLYKNKRIFRNIMENIGTV
GGDLTRSFRNNYKGSMFNKWGSKDPEQEAAMLKRGGYVGGLVNDGNTCFMNSVLQSLASS
KTLLQFLDNEVIQAYKEAEESEDEHVAEKEFESEKKLSESKTKPKKKVYGKRKKRLTRNA
EKDALDDDQDANIEFSTTLKELLNKLNAKHYRDRPYFKTNKLLKTMSKAPNKSIILGYDQ
EDAQEFFQTILSELEKNVKSLYGKSSKDEEAPVQFDQLPEDSMVGQERLGEMGTVYIPTE
QIDPNCVLAHENKSLYSPFKLITPLDGLTAERIGCLQCGENGGIRYSVFSGLSLNLPSEN
LGSTLKLSELLREWIKPEIIEGVECNRCALNAVLEHLEKTLIQYEGSEHSSEKLVAAVKA
RVEQLKDILAKPAIDDDDYKKLHTENMVRKCSKSKQIIISRPPPLLCIHINRSVFDPRTY
MIRKNNSRVLFKSKLNLAPWCCAPDEINLDARLPMSKKEQKSLESSEDENVGGEYFAKLH
RHFEEEFEDSEEEEGNFEASNRDVSDYDPLRGEIESSSDENESSSDGEYEVDALGNRVFK
QNGAQTEQELVDGTSADPEVASLEGSDAAERLDGIEPETLDNEDEEDSESDHEVKQPPSL
SSLHHAPSSSTVPVGPLTYALRSVIVHYGTHNYGHYIAFRKFRGLWWRISDETVYVVDEA
EVLSTPGIFMLFYEHDYNESLHAMNDDLEWEEENEDRE
NT seq 2277 nt NT seq  +upstreamnt  +downstreamnt
atgaattttgttttggaaaaactgtccgcattatttagtacattgagcatcttcgttaga
aacttgagccatatcgataataaaagctcaacattaattgtacttattgcatcaactgga
atactactatacaagaacaaaagaattttcagaaatatcatggaaaatataggaactgtg
ggcggcgatctaacccgaagctttaggaataactacaaaggaagtatgttcaataagtgg
ggttcgaaagatccagagcaagaagctgccatgctgaagcgtggcggctacgttggtggg
ctggtcaatgacggtaatacttgctttatgaactctgtgctgcaaagtttagcatcttca
aaaactttactgcagtttttggataacgaagtcatccaagcgtataaggaagccgaagaa
agtgaggatgagcatgtagcagagaaagaatttgagagcgaaaaaaagctttctgagtct
aaaacaaagcctaaaaagaaggtttatggcaaacgcaagaagaggctgactagaaacgcc
gaaaaggatgcattggatgacgaccaagatgcaaacattgagttcagtaccacactgaag
gagcttttaaacaagctgaatgcaaagcattacagggataggccctacttcaaaacaaac
aaactgctcaagactatgtctaaagccccaaacaaaagcattattcttgggtacgaccaa
gaagacgcacaagagtttttccagaccatcttgtcagaacttgaaaagaacgtgaaatct
ctttacgggaaatcatccaaggatgaagaagctccagtgcaattcgatcaactgcccgaa
gattctatggttggtcaagaaagactaggcgaaatgggcactgtctatattcccactgag
cagattgaccctaactgcgtactggctcatgaaaataaaagtctttattcccctttcaag
ctcatcactcccttggatggtctaacggcagagaggataggatgcttgcagtgtggtgaa
aatggtggcattcgttattctgtgttttccgggttaagcttgaacctgcccagcgaaaac
ctgggctcaactttaaagctttcggagcttcttcgtgagtggataaaacctgaaatcatt
gaaggagttgaatgcaatcgctgtgctctcaatgcagtgcttgaacacctcgagaaaact
ttgattcaatacgagggctcagagcattcttcggagaagcttgtcgccgccgtcaaagct
cgcgtagagcaactgaaagacatattggccaaacctgctattgatgacgatgactacaaa
aaactgcataccgaaaacatggttcgaaagtgctccaagtctaagcagataattatctct
cgtcctccaccgctactctgcatccacattaatagatctgtttttgatccccgcacatac
atgatcagaaaaaacaactccagagttttgttcaaatctaaactcaatttagctccatgg
tgttgcgcgcctgatgaaataaacctcgatgcccgtctccccatgtccaaaaaagaacaa
aaatcgttagagtcatctgaagacgagaatgtcgggggtgagtacttcgccaaattacac
agacactttgaggaggagtttgaagacagcgaagaagaagagggcaactttgaagcatct
aacagagatgtatctgactacgatcctctaagaggcgaaatagaatcttcgagtgacgag
aacgagtcgtcctcggatggcgagtatgaagttgatgctctaggaaaccgcgtcttcaag
caaaatggtgcccagactgagcaggagctagttgatggaacctctgctgatccagaggtt
gcctctcttgagggctcggatgccgcggaaagacttgatggtattgagcctgagacactt
gataacgaagacgaagaagacagcgaaagcgaccatgaagttaagcagccaccttctctt
tcatctttgcaccatgctcctagctcctcaaccgttcctgtcggtcctttgacctacgcc
ttgcggtctgtcattgtacactacgggacacacaactacggacactacattgcattcagg
aagtttagaggcctgtggtggagaatatctgatgagacggtctacgttgtggacgaagca
gaggttctctccacaccaggaattttcatgctattttatgagcacgattacaatgagtcg
cttcacgcaatgaacgatgacctggagtgggaggaggaaaacgaggacagggagtga

DBGET integrated database retrieval system