KEGG   Lachancea thermotolerans: KLTH0G12188gHelp
Entry
KLTH0G12188g      CDS       T01117                                 

Definition
KLTH0G12188p
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
lth  Lachancea thermotolerans
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:lth00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    KLTH0G12188g
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    KLTH0G12188g
  Amino acid metabolism
   00310 Lysine degradation
    KLTH0G12188g
Enzymes [BR:lth01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     KLTH0G12188g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
G:1035434..1036759
Genome map
AA seq 441 aa AA seqDB search
MFRSSPRVARPIASCVSKRNLARVASGFALPQSSCIASQFQNYFLVQRVAASRMASTTVK
VPPMAESLTEGSLKEFTKQVGEYIKQDELLATIETDKIDVEVNAPTSGKVTKLHFQPEDT
VTVGDDLAEIEPGAAPEGGKEAAPEPAKETPKSEEPAPKEDQPAAAPKPQESAPKEEPKK
AAAPPPPPQPKKESAPQKESSPAPPSGSFSRSEQKVKMNRMRMRIAERLKESQNTAASLT
TFNECDMSALLDMRKLYKDEIIKKTGVKFGFMGLFAKACTLAAKDIPTVNAAIEGDQIIY
RDYTDISIAVATPKGLVTPVVRNAESLSVLEVEQEITRLGKKARDGKLTLEDMAGGTFTI
SNGGVFGSLYGTPIINMPQTAVLGLHGVKERPVTVNGQIVSRPMMYLALTYDHRLMDGRE
AVTFLKTVKELVEDPRKMMLM
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgttcagatctagccccagagttgcgagacctatcgcttcgtgcgtgagcaagagaaac
ctggccagagtagccagtggattcgcgctcccccagtctagctgtatcgctagtcagttc
caaaactacttccttgtccagcgtgtcgcggcatcgaggatggcctcgaccactgtgaaa
gtaccacctatggccgaatcactgactgagggatccctcaaagaattcaccaaacaagtc
ggcgaatacatcaaacaagatgagctcttggctactatcgaaacagataaaatcgacgtg
gaagttaacgctccaacgtcaggaaaagtcactaagcttcactttcagccagaggacact
gtgactgtgggcgatgaccttgccgagatcgagcctggcgctgctccagaaggcggcaag
gaggctgccccagaacccgccaaggaaacccctaagtcggaggagcctgctcccaaagag
gaccagcctgccgccgctcccaagccacaggaatcagctccaaaggaagagcccaaaaag
gctgctgctccacctcctcctcctcagccaaagaaggagtctgctcctcaaaaggagtca
agtcctgcacctccatccggaagcttctctcgttccgagcaaaaggttaaaatgaaccgt
atgcgtatgaggattgcagagagattaaaggagtctcaaaacactgctgcttctctaacc
accttcaacgaatgtgacatgtctgctttgctggacatgcgtaagctctacaaggacgaa
attatcaagaaaactggtgttaagtttgggttcatgggacttttcgcaaaggcctgtact
ttggctgcaaaggacattccaactgtgaatgctgctatcgaaggggaccaaatcatctac
cgcgactacaccgacatttccattgctgtggctactcctaaaggccttgtcacaccagtg
gtacgtaacgccgagtctctgtcggttctagaggtcgagcaagagatcactcgtcttgga
aagaaagctcgcgatggtaagctcactcttgaagacatggcaggcggcacctttactatt
tccaacggtggcgttttcggttccctgtacggtactccaattattaacatgcctcagacc
gcggttttgggccttcatggtgtcaaggagagacccgttaccgttaatggccagattgtt
tccaggccaatgatgtatctagctttgacttacgaccacagactgatggatggtagagaa
gctgtcactttcctgaagaccgtcaaggaactggttgaagaccccagaaagatgatgctt
atgtag

DBGET integrated database retrieval system