KEGG   Lachancea thermotolerans: KLTH0G12210gHelp
Entry
KLTH0G12210g      CDS       T01117                                 

Definition
KLTH0G12210p
Orthology
K00866  
choline kinase [EC:2.7.1.32]
Organism
lth  Lachancea thermotolerans
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Module
Phosphatidylcholine (PC) biosynthesis, choline => PC
Brite
KEGG Orthology (KO) [BR:lth00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    KLTH0G12210g
Enzymes [BR:lth01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     KLTH0G12210g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
G:complement(1036985..1038592)
Genome map
AA seq 535 aa AA seqDB search
MSERTGRKSSGAKTSRSSSSNVRRPSLPRLRSSPRLVRTISAESETLTRAVSHLSLDGGA
QDSIWVPFVKGVLNASLPHEYLRADVLNLAQALKLPKWHNKKGSTTHLIPNLVKLTKITG
ALTNAIFKVEYPSLPSLLLRVYGPQVESIIDRDYELKVLARLSSHNVGPKLYGCFTNGRF
EQFLENSTTLTRHDIRDWHTSQRIARRMKELHTGVPLLPFEIKQGPISWFRMDKWLKVFE
QSKWSRNDSNIQEVLLADSFTRFLEMVQRYRNWLDEAYRGSKDDLAFCHNDAQYGNLLFT
SPVAPPVTAPTSSAASIESSNSLFPTSSNISVDQIINPPQQEQAQDSKLVVIDFEYSGAN
RPAFDLANHFSEWMCDYNCSEAYKSDETKYPTKAELLNFLYSYASHRRSSHNGTIDKEVR
ELYNDVIRQRACVSLHWCMWAIIQSGELDDAKKDKVIEEGPGGEKYVITVDPDDEGAVED
SDSSVDGVDIDTFDNIRFATEKIAIFWGDLLQLGLVKKEELPNGIKLKLLDTAFL
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaaagaacaggtaggaaaagttcaggagccaagacatcaaggtcgagctcaagt
aatgtgagaaggccatccctaccccgcttgagaagctcgccaagattagtccgcactatt
agcgccgagagtgaaactcttacacgagctgtgagtcatttgagccttgacggcggagcg
caggatagcatatgggtaccgtttgtgaaaggcgttttaaatgccagtttgccgcacgaa
tatctccgcgccgatgtgttgaacttggcacaagctttgaagctgcccaaatggcacaac
aagaaaggaagtaccacccatttgattcccaatcttgtcaagctaaccaagattacaggt
gctctcacgaacgcaatcttcaaagtcgagtatccctcactgccctcgctgctacttcga
gtgtacggtccacaggtggagagcatcattgatcgcgactatgagctaaaagtgctggca
cgattatcatcgcataatgtggggcccaagctttacgggtgctttactaatggccgtttt
gaacagtttttagaaaactcaactaccctcacccgccatgatatcagagattggcacaca
tcgcagaggattgctcgccgaatgaaagagttgcatacaggtgttccgctacttcctttt
gaaataaagcaaggccctatctcatggttcagaatggacaagtggctaaaggttttcgag
cagtcgaaatggtctcgtaatgattctaatattcaagaggtgttactcgcggatagcttc
actcgttttcttgaaatggttcaaagataccggaactggctggatgaagcctaccgcggc
tcaaaagatgatttggcattctgccataacgacgcccagtacggtaacttactgttcacc
tcaccagtggctcctcctgtgacagctcctacatcttccgcagcctcgattgaatcttcg
aactccttgttccctacaagttccaacatctcggttgaccagattatcaacccccctcag
caagaacaggcacaagattccaaactagttgtaattgattttgaatattcgggagccaac
cgccctgctttcgatctagcaaatcatttcagcgagtggatgtgcgattataactgctcc
gaagcgtacaagtcagatgagacaaaataccccacaaaagccgaattgctcaacttcctt
tactcctatgcctctcacagaaggtcgtcgcataatggaactattgacaaagaagtaaga
gagctttacaatgacgttataagacagcgcgcttgtgtttctctgcactggtgcatgtgg
gccattatccagagcggcgaacttgacgatgccaagaaagataaagtcattgaggagggc
cccggtggcgagaagtacgtgatcactgtggaccccgacgacgagggggcagttgaggat
tctgacagtagcgtggacggcgtggacattgataccttcgacaatatacgatttgctacc
gaaaagatagctatattctggggcgaccttctccagctgggtttagtgaaaaaggaagag
ctaccaaacggtattaaattgaagttactagatacagcgttcttgtaa

DBGET integrated database retrieval system