KEGG   Lachancea thermotolerans: KLTH0G12738gHelp
Entry
KLTH0G12738g      CDS       T01117                                 

Definition
(RefSeq) KLTH0G12738p
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
lth  Lachancea thermotolerans
Pathway
lth04011  MAPK signaling pathway - yeast
lth04139  Mitophagy - yeast
lth04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:lth00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    KLTH0G12738g
 Cellular Processes
  Transport and catabolism
   04139 Mitophagy - yeast
    KLTH0G12738g
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    KLTH0G12738g
Enzymes [BR:lth01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     KLTH0G12738g
Protein kinases [BR:lth01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   KLTH0G12738g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase Kdo APH Kinase-like Ribosomal_60s RIO1 FTA2
Motif
Other DBs
NCBI-GeneID: 8293869
NCBI-ProteinID: XP_002555586
UniProt: C5DMY8
Position
G:complement(1085500..1086804)
Genome map
AA seq 434 aa AA seqDB search
MAAQEEFIRTQIFGTVFEITNRYTDLNPVGMGAFGLVCSATDTYTGQSVAIKKIMKPFST
AVLAKRTYRELKLLKHLRHENLICLEDIFLSPLEDIYFVTELQGTDLHRLLQTRPLEKQF
VQYFLYQILRGLKYVHSAGVIHRDLKPSNILINENCDLKICDFGLARIQDPQMTGYVSTR
YYRAPEIMLTWQKYNVEVDIWSAGCIFAEMIEGKPLFPGKDHVHQFSIITDLLGSPPEDV
INTICSVNTLKFVTSLPHRDPVPFSERFKNVEPDAVDLLEKMLVFDPNKRITAADALSHP
YLAPYHDPTDEPVADAKFDWHFNDADLPVDTWRVMMYSEILDFHQIGDNQIDPNATFDDQ
VAAATAAAQAAQAAQQHQSSQQQSQDPSERTHHSPDQQKSAHHSSAEHLPNDSRPNETLN
SYANQAAQYASEFQ
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atggcagcccaggaagagttcatcagaacgcaaatcttcggcaccgtgttcgaaatcaca
aaccgctacaccgacctcaacccggtcggcatgggcgccttcggcctcgtctgctccgcc
accgacacctacacgggccagtccgtcgccatcaagaaaatcatgaagccgttctccacc
gcggtgctcgccaagcgcacataccgcgagctcaagctgctcaagcacctgcgccacgaa
aacctcatctgtctcgaggacatcttcctctcgccgctcgaggacatctacttcgtcacc
gagctccagggcacggacctccaccgcctcctgcagacgcggcccctggaaaagcagttc
gtgcagtacttcctgtaccagatcctcagaggcctgaagtacgtgcactccgcgggcgtc
atccaccgcgacctcaagcccagcaacatcctcatcaacgagaactgtgacctgaaaatc
tgcgacttcggcctcgcccgtatccaggacccgcagatgaccggctacgtgtccaccagg
tactaccgcgcgcccgagatcatgctcacctggcaaaagtacaacgtcgaggtcgacatc
tggtccgcgggctgcatcttcgccgagatgatcgagggcaagccgctcttccccggcaag
gaccacgtccaccagttctccatcatcaccgaccttttgggctcgcccccggaggacgtc
atcaacaccatctgctctgtgaacaccctcaagttcgtcacctccctgccccacagagac
cccgtgcccttctccgagcgcttcaagaacgtcgagcccgacgccgtcgacttgctggag
aaaatgcttgttttcgaccccaacaagagaatcaccgccgccgacgccctgtctcaccca
tacctggccccataccacgaccccaccgacgagccggtcgccgatgccaagttcgactgg
cacttcaacgacgcggacctgcccgtcgacacctggagggtcatgatgtactccgaaatc
ctagacttccaccaaattggcgacaaccagatagatcccaacgccacctttgatgaccag
gtcgcagccgccactgccgctgcccaggccgcccaggccgctcagcagcaccaatcttca
caacagcagtcgcaggacccttcggagcgcacacaccactcacccgaccagcaaaaatca
gcgcaccattcctctgccgagcacctcccaaacgattcgcgccccaatgaaacattgaac
tcttatgcgaatcaagctgcacagtacgcttctgagtttcaataa

DBGET integrated database retrieval system