KEGG   Lachancea thermotolerans: KLTH0G13662gHelp
Entry
KLTH0G13662g      CDS       T01117                                 

Definition
KLTH0G13662p
Orthology
K00814  
alanine transaminase [EC:2.6.1.2]
Organism
lth  Lachancea thermotolerans
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:lth01200]
Metabolism; Overview; 2-Oxocarboxylic acid metabolism [PATH:lth01210]
Metabolism; Overview; Biosynthesis of amino acids [PATH:lth01230]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:lth00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
G:1169989..1171548
Genome map
AA seq 519 aa AA seqDB search
MMLSRQLTRTMPHSRLILRRLSAKAAVKSDLSQKALGSKKTLRDVNQCVLNAKYAVRGPI
PLRAEELRHKLVEEPGSLPFNKIINANIGNPQQLDQKPLTFYRQVLSLLQNPALIESLPT
GELHKLFKPDAVERAKKMLKQVGGSVGAYSASQGVAGFRQSVAEFIEERDGEPASANDIF
LTAGASSAVSAILSMFCTGSENGALIPIPQYPLYTATLALNDAHALPYYLDEASGWSMDT
EQVEQVVKDAIRKGVRPTCLVVINPGNPTGAILSPEAIEKILTVAAKYSLVVIADEVYQE
NGFDDADFVSMKKVLRVLQKTEPGKYDNVQLASLHSTSKGVSGECGQRGGYMELVGFSEE
VKQVFLKLASISLCPVVTGQALVDLMVRPPKKGDASYELDRQERNAIHNSLHQKSTLLYE
TFQSLEGVSCQKPQGAMYLFPKLDLSRKAIRKAESLGMAPDEYYCKELLEATGICTVPGS
GFRQVPGTYHLRTTFLAPGTEWVDSWKKFHQKFVDEHRD
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgatgttgtcaagacaattaaccagaacaatgcctcattccaggctcatattgcgtcgc
ttgagtgccaaggcggctgtaaagagcgacctttcccaaaaagctctgggaagcaagaaa
acgcttcgcgatgtcaaccagtgtgtgctcaatgcgaaatatgctgtgagaggtccaatt
ccattacgtgcagaagaattaaggcataagcttgttgaagagccgggatctcttcctttc
aacaaaattattaatgccaacattggtaatcctcagcaactagatcaaaaaccgctgaca
ttttacagacaggttctgtccctcctacaaaatccagctctgattgaatctcttcccacc
ggagagctacacaagctgttcaagccagatgccgttgagcgtgctaaaaaaatgctcaag
caggtgggcggttccgtaggagcatactcggcttcccagggtgtggcaggtttccgccaa
tcggtcgctgagtttattgaggaacgtgatggcgagccggcctctgccaatgatattttc
cttactgccggtgcttcaagtgcggtttctgccatcttgtcgatgttttgcactggttcg
gaaaacggagccctgattcctattccgcagtatccactttacaccgctacgctggcgctg
aacgatgcgcacgcactaccatactaccttgacgaagcttctggttggtctatggacaca
gagcaggttgagcaggtcgtaaaagatgcgattagaaagggcgtgcgtccaacttgcctg
gttgtaatcaacccaggcaacccaactggagctattttgtcgcctgaagccattgaaaag
atcttgacagttgctgcgaagtatagcttggttgtcattgccgatgaagtgtaccaagag
aatggtttcgacgacgccgactttgtgtcgatgaagaaggttctaagggtactacaaaaa
accgagcccgggaaatatgacaacgttcaattggcgtctctgcattccacctcaaaaggt
gtatctggtgagtgtggccagagaggtggctacatggaacttgttgggttttcggaggag
gtcaaacaagtgtttttgaagctagcgtccatctctctatgtcctgtcgtaaccggtcaa
gcactagttgacttgatggtgcgtcctcccaagaaaggcgatgcttcctacgaattagac
cgccaggagcgcaatgcaatccacaattcgctgcatcaaaagtcgactttactatatgaa
actttccagagtctggaaggtgtatcttgccaaaagccccagggtgcaatgtatcttttc
cccaagcttgatctttctagaaaagctattcgcaaggccgagtctcttggtatggcccct
gacgaatattactgcaaggagcttctagaggcaactggcatttgcactgttcctggatct
ggcttccgccaagttcctggtacctatcatttaagaaccaccttcctagccccaggcacc
gagtgggtggattcctggaaaaaattccaccaaaagtttgttgacgaacaccgtgattag

DBGET integrated database retrieval system