KEGG   Lachancea thermotolerans: KLTH0G13662gHelp
Entry
KLTH0G13662g      CDS       T01117                                 

Definition
KLTH0G13662p
Orthology
K00814  
alanine transaminase [EC:2.6.1.2]
Organism
lth  Lachancea thermotolerans
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lth00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    KLTH0G13662g
   01210 2-Oxocarboxylic acid metabolism
    KLTH0G13662g
   01230 Biosynthesis of amino acids
    KLTH0G13662g
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    KLTH0G13662g
Enzymes [BR:lth01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     KLTH0G13662g
Amino acid related enzymes [BR:lth01007]
 Aminotransferase (transaminase)
  Class I
   KLTH0G13662g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
G:1169989..1171548
Genome map
AA seq 519 aa AA seqDB search
MMLSRQLTRTMPHSRLILRRLSAKAAVKSDLSQKALGSKKTLRDVNQCVLNAKYAVRGPI
PLRAEELRHKLVEEPGSLPFNKIINANIGNPQQLDQKPLTFYRQVLSLLQNPALIESLPT
GELHKLFKPDAVERAKKMLKQVGGSVGAYSASQGVAGFRQSVAEFIEERDGEPASANDIF
LTAGASSAVSAILSMFCTGSENGALIPIPQYPLYTATLALNDAHALPYYLDEASGWSMDT
EQVEQVVKDAIRKGVRPTCLVVINPGNPTGAILSPEAIEKILTVAAKYSLVVIADEVYQE
NGFDDADFVSMKKVLRVLQKTEPGKYDNVQLASLHSTSKGVSGECGQRGGYMELVGFSEE
VKQVFLKLASISLCPVVTGQALVDLMVRPPKKGDASYELDRQERNAIHNSLHQKSTLLYE
TFQSLEGVSCQKPQGAMYLFPKLDLSRKAIRKAESLGMAPDEYYCKELLEATGICTVPGS
GFRQVPGTYHLRTTFLAPGTEWVDSWKKFHQKFVDEHRD
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgatgttgtcaagacaattaaccagaacaatgcctcattccaggctcatattgcgtcgc
ttgagtgccaaggcggctgtaaagagcgacctttcccaaaaagctctgggaagcaagaaa
acgcttcgcgatgtcaaccagtgtgtgctcaatgcgaaatatgctgtgagaggtccaatt
ccattacgtgcagaagaattaaggcataagcttgttgaagagccgggatctcttcctttc
aacaaaattattaatgccaacattggtaatcctcagcaactagatcaaaaaccgctgaca
ttttacagacaggttctgtccctcctacaaaatccagctctgattgaatctcttcccacc
ggagagctacacaagctgttcaagccagatgccgttgagcgtgctaaaaaaatgctcaag
caggtgggcggttccgtaggagcatactcggcttcccagggtgtggcaggtttccgccaa
tcggtcgctgagtttattgaggaacgtgatggcgagccggcctctgccaatgatattttc
cttactgccggtgcttcaagtgcggtttctgccatcttgtcgatgttttgcactggttcg
gaaaacggagccctgattcctattccgcagtatccactttacaccgctacgctggcgctg
aacgatgcgcacgcactaccatactaccttgacgaagcttctggttggtctatggacaca
gagcaggttgagcaggtcgtaaaagatgcgattagaaagggcgtgcgtccaacttgcctg
gttgtaatcaacccaggcaacccaactggagctattttgtcgcctgaagccattgaaaag
atcttgacagttgctgcgaagtatagcttggttgtcattgccgatgaagtgtaccaagag
aatggtttcgacgacgccgactttgtgtcgatgaagaaggttctaagggtactacaaaaa
accgagcccgggaaatatgacaacgttcaattggcgtctctgcattccacctcaaaaggt
gtatctggtgagtgtggccagagaggtggctacatggaacttgttgggttttcggaggag
gtcaaacaagtgtttttgaagctagcgtccatctctctatgtcctgtcgtaaccggtcaa
gcactagttgacttgatggtgcgtcctcccaagaaaggcgatgcttcctacgaattagac
cgccaggagcgcaatgcaatccacaattcgctgcatcaaaagtcgactttactatatgaa
actttccagagtctggaaggtgtatcttgccaaaagccccagggtgcaatgtatcttttc
cccaagcttgatctttctagaaaagctattcgcaaggccgagtctcttggtatggcccct
gacgaatattactgcaaggagcttctagaggcaactggcatttgcactgttcctggatct
ggcttccgccaagttcctggtacctatcatttaagaaccaccttcctagccccaggcacc
gagtgggtggattcctggaaaaaattccaccaaaagtttgttgacgaacaccgtgattag

DBGET integrated database retrieval system