KEGG   Lachancea thermotolerans: KLTH0G17512gHelp
Entry
KLTH0G17512g      CDS       T01117                                 

Definition
KLTH0G17512p
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
lth  Lachancea thermotolerans
Brite
Enzymes [BR:lth01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     KLTH0G17512g
Protein kinases [BR:lth01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [Table]
   KLTH0G17512g
Exosome [BR:lth04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   KLTH0G17512g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
G:complement(1518329..1519426)
Genome map
AA seq 365 aa AA seqDB search
MARTITFDIPSCYQLVELVGEGAYGTVCSAVHKPSGTKVAIKKIQPFAKQMFVTRTLREL
KLLKLFHSHENIISVLDVVRPTSMDKFQAVYLVQELMETDLHKVISGGGSSLSDDHIQYF
TYQILRALKAIHSAQVIHRDIKPSNLLLNSNCDLKVCDFGLARCLASSTHSRQNLVGFMT
EYVATRWYRAPEIMLTFQQYTTAMDIWSCGCILAEMITGKPLFPGRDYHHQLWLILEAVG
TPSYEDFENINSKRAKEYIANLPLRQKLPWQVVLQTQEVNPDAIDLLDRMLTFNPDKRIS
AVEALSHPYLSVYHDPEDEPEYPPLNLDDPFWKIDNDLKQPSEESELSIDTLKQMLFEEV
GKPLH
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atggctagaactattacatttgacattccgtcctgctaccagctggttgagctagttggc
gaaggggcttatggtacagtatgctcggcagtgcataagccttcgggtactaaggttgct
atcaagaagattcaaccatttgccaaacaaatgtttgtaacccgaacgttacgggaactt
aaactgcttaaactattccatagccatgaaaacattattagcgtactggatgttgtgcgg
ccaacgtctatggacaaattccaggcagtctacctggtacaagagcttatggagacggac
ctgcacaaggtcatcagtggcggcgggtccagcctcagcgatgaccatatacaatacttc
acgtatcagattttacgagccctcaaggcgatacacagtgcacaggtgattcatcgagac
atcaaaccttcgaatctgctgttaaactctaattgcgacctcaaggtgtgtgactttggg
cttgctcggtgcctggcatccagcacccactcacgtcaaaacctcgtggggttcatgact
gagtacgttgccacaaggtggtaccgagcacctgaaattatgctaactttccagcaatac
acaaccgcaatggacatctggtcctgtggatgcatcctggcggagatgattacaggcaaa
ccgcttttccccggacgcgactatcaccaccagctatggctcatccttgaagcagtaggt
acgccatcttacgaagattttgaaaacatcaactcgaaacgcgcgaaggaatacatcgct
aaccttccacttcggcaaaagttaccgtggcaagtagttctacagacgcaagaagtcaat
ccagatgccattgacctactggatcggatgctcacttttaaccctgacaagcgcattagc
gctgttgaggccctcagccatccgtacctaagcgtataccacgacccggaggacgaacct
gaatacccgcctctcaacttagacgatccgttctggaaaatcgataatgacctcaaacag
cctagcgaggaaagtgagctttccatagacaccctaaagcagatgctgtttgaagaagtc
ggaaaaccactgcattaa

DBGET integrated database retrieval system