KEGG   Lachancea thermotolerans: KLTH0H00550gHelp
Entry
KLTH0H00550g      CDS       T01117                                 

Definition
KLTH0H00550p
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
lth  Lachancea thermotolerans
Brite
Enzymes [BR:lth01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     KLTH0H00550g
Transcription machinery [BR:lth03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     KLTH0H00550g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
H:complement(58659..59945)
Genome map
AA seq 428 aa AA seqDB search
MTSKRKDGAEEGSEAKRQKVERNVKDEPESQPEVVDLLEEQPATESRANSGDKEEKESDE
AGVTHFTFDGQEYKFKERASVIEEKEGKIEFRVVNNDNTKENMMVLTGLKNIFQKQLPKM
PKEYIARLVYDRSHLSMAVVRKPLTVVGGITYRPFDNREFAEIVFCAISSTEQVRGYGAH
LMNHLKDYVRATSKIKYFLTYADNYAIGYFKKQGFTKEISLDKSVWMGYIKDYEGGTLMQ
CSMLPRIRYLDAAKILLLQEAAVQRKVRLMSKSYVVHPGLKIFKDLENIKPIDPMEIPGL
KESGWTPEMDELAQRPKRGPHFAAMQNVLTELQNHAAAWPFLQPVNKDEVPDYYEFIKEP
MDLSTMEIKLENNRYEKMENFFYDARLIFNNCRAYNGENTSYFKYANRLEKFFNTKMKEI
PEYSHLVD
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgacctcaaagagaaaggatggggcagaagaggggagcgaggcgaagcggcaaaaagtt
gagagaaatgtgaaggacgaaccggaatcccaacctgaagtagtagacctcttggaagaa
cagccggcaacagagagtcgagcaaactcaggagacaaagaagagaaggaaagcgatgag
gcaggggtcacgcactttacatttgacggacaagaatacaaattcaaggagagagccagc
gttattgaagagaaggaggggaaaatcgagtttagagtagtgaataatgacaatacaaag
gaaaacatgatggttttgacggggctcaaaaacattttccaaaaacagcttcctaagatg
cccaaagagtatatcgcgcgactggtgtacgaccgcagtcacttgtcgatggctgtcgta
cgaaaaccgcttacagttgtaggcggaattacttacaggccctttgacaatcgtgagttt
gccgaaatagtattttgtgcgattagttcaacagagcaggtccggggttacggtgcacac
ttgatgaaccatttaaaggactacgtgcgagcaacttcgaagatcaagtacttcctcact
tacgcagataattatgccatagggtatttcaaaaagcaaggtttcacaaaggaaatatca
cttgacaaaagtgtttggatgggatacattaaggactacgaaggaggtacgttgatgcaa
tgctctatgctcccgcgaataagatatttggacgctgccaagatcttacttctccaagag
gcagcagtccaacggaaggtaaggctcatgtcaaaaagttatgtcgttcaccctggttta
aaaatattcaaagaccttgaaaatattaaaccaattgaccctatggaaattccgggcctg
aaagagtcaggatggactccagagatggatgagctggctcagaggccgaaaagaggaccc
cacttcgcggcaatgcaaaacgttttaactgaattgcagaatcatgcagcagcgtggccg
tttttgcaacctgtcaacaaggacgaagttccggattattacgaattcatcaaagaacca
atggacttgagcacaatggaaataaaattagaaaacaaccgctacgaaaaaatggagaac
tttttctatgatgcgcgtctcatcttcaataattgtcgtgcgtacaatggcgaaaataca
tcttacttcaagtatgccaacagacttgaaaaattcttcaatactaaaatgaaggaaatt
ccagagtattcacacttagttgattag

DBGET integrated database retrieval system