KEGG   Lachancea thermotolerans: KLTH0H01584gHelp
Entry
KLTH0H01584g      CDS       T01117                                 

Definition
KLTH0H01584p
Organism
lth  Lachancea thermotolerans
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
H:143065..144453
Genome map
AA seq 462 aa AA seqDB search
MSFASQDVSLRQKSRPGESGLFQPSSLKRKNLKKLTLGGAVGTGRGLRTDNMVPVSITGS
SGSNGIEAPLGLNGIPNGDLRGYGSSGVSPTSDPSSAGITPTEEVPGLTSDLENLSLFQD
TTIELQDLVQLGKIGSGNSGTVLKTLHVPDSRIIAKKSIPVENKQLVKSQLMRELSIMRN
VKPHDNIVGFFGAFYTASTSNEIVILMEYMDCGSLDKIMSTYKAFVARGIQSPTENWFSE
PVLSKISFAVLNGLLYLYRGYKIIHRDIKPSNVLINSKGCVKICDFGVSKKLINSIADTF
VGTSTYMSPERIQGSVYSTKGDVWSLGLMIIELVTGEFPLGGHSDTPEGILDLLQRIVNE
PPPRLPPQLPNGLQYSREMFDFVNRCCVKDERERSSLQELLCHDFIEKSRSQGDREFRHW
CKRIKKWLKEDKMLRREEQERAKLVKRQLESAANAATAARHR
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgagctttgcgagccaagatgtgagcttaaggcagaaaagtaggcccggcgagtccgga
ctatttcagccttcgtcgctcaaacgaaagaatctgaagaaactgactctaggtggcgct
gtgggcacgggacgcgggctgcgaacggacaacatggtgcccgtaagcatcaccggtagt
agcggcagtaacggcattgaggcgcctctgggcctgaatgggataccgaacggcgacttg
cggggttacggaagttccggcgtgagccctacgtcggatccgtcatctgcaggcatcaca
ccgaccgaggaagttcctggcctgacatcggacctggagaacctgtcgctatttcaagat
acgaccatagagctccaggacctcgtgcagctgggaaaaatcggttccggcaattccggg
actgtgctcaaaacgctgcatgtaccggactcgcggattattgccaaaaaatcgattccc
gttgagaacaagcagctcgtcaaaagccagctcatgcgtgagctctccatcatgcgaaat
gtcaagccacacgataacatcgttggcttcttcggagccttttacactgcctccaccagc
aacgagatcgtgatacttatggagtacatggactgcgggtcgctcgacaagatcatgtca
acttataaggcatttgtggcacgcggcatacagtcgccaactgagaactggttctccgag
cctgtgctatcaaagatttctttcgcggttctaaacggcctgctgtatctgtaccgaggc
tacaaaattatccaccgagacatcaagccttccaatgtgcttataaacagcaagggctgc
gtcaagatatgcgactttggagtatcaaaaaaactaatcaactccatcgcggacactttc
gttgggacgtcgacttatatgtctcccgaacgtatccagggaagcgtttactccactaag
ggtgacgtttggtcgctcgggctcatgatcatagagttggtaacaggtgagttcccactg
ggaggccattccgacacacctgagggtatattagatttactgcagcgtattgtgaacgaa
ccgccaccaaggttgccgccgcaactaccaaatggattgcagtactcacgcgagatgttt
gattttgtcaatagatgttgtgtcaaggacgagcgcgagagatcgtcattgcaagagctt
ctgtgccacgatttcattgaaaaaagccggtcgcagggagatcgggagttcagacattgg
tgtaagcgcataaagaaatggttaaaagaggacaagatgctcaggcgcgaggaacaagag
cgagctaaactggtgaaacgccagctggagagcgctgccaacgccgccactgcagcaaga
catcgctaa

DBGET integrated database retrieval system